KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326151
Entry
4326151           CDS       T01015                                 
Name
(RefSeq) serine/threonine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4326151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4326151
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4326151
   03400 DNA repair and recombination proteins [BR:osa03400]
    4326151
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4326151
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   4326151
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    4326151
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    4326151
SSDB
Motif
Pfam: PI3_PI4_kinase FATC TAN
Other DBs
NCBI-GeneID: 4326151
NCBI-ProteinID: XP_015615410
LinkDB
Position
1:335703..371194
AA seq 2995 aa
MATSRDADEIIEKLSSDRARTRDEGVKLLGTWLQGDRAFSFCRLLARNTANLKPAHLPAS
ATWPFLIMALTKCVIADISGKKRSPKSAAARMLRLAVQCAQDFRLSGRSLLLISVAKKLF
SHIWEVVKDAPSFLIEYSIILRQLLTVKEYRYQMKPRTYSSFVVLYMKKVATGFDEKISN
QASSKEESFRCTLTLHVLLENPPGDYPDIMREEVLCGFCAICSNIREEGKLTRKLIECVN
TFLLKDGPNLGCKSVDIHNAVQDFMFHSWPVTHDRALKSLFITYAKVQLELARAIPEILE
KLLDVIIKELDQNFNTGAGLVWCEAPRDEKAGSLRCFQEELMDLSATALYLAYKCTPRTS
HNKKKLKTEHVMTAIMDSLLRGSLVWSGSICCLIHKYGYRVDKSLLINWFKATCKGLKSV
LSNANALRFQDSLLWLIRVLKEFSALLMSSARDAPPFWLTNDEMSILEGYWQDTWNSLIH
ALPLFSTTALVVDSVLRLLGEMIMRDQVHASFVSEDTWDLQIFKQLPSSSTLYFIACYFS
KIGFQGDVSNSIFIRKNLLRSTFELVHSKGFSLLNEQSVLMIPETIFSLCAGFSSPVINS
ADTSQLFGECKNLSKDKCWSHEEELGYSVETLSEINLESPTKAMSEKCSRAHLPRHIQQP
LLLELLEFTKGFMSSNKQFEKVDLPNLVYACSLVCNLIHCSLLSRVFEEKSSFLQVMLDY
VTNAIKHIVSVVMKEHAELSHGLTNLGSVFDTTGSALSSFKSFMHSPLFSLWRVNNKTSS
VLGVTELLDELLEAISELFAQFSSLMNNFDGDNPSKMLPVPFVSLSEDLHPDNRSSFVDM
DLDMTGSGEVDPVTAGGSGSMGISPRPLECKLELVCIISTFFSVVPLHTWEVLYNLADKE
VNIKVGQAILLELCTNISASSSSLSSVLNLVVDMWERSACTLLSSADCLAHVHALLRNLT
ANCDVGHNTDGRSQGCKVASNENQDVFLDLLNKATEISFTDWFFRIRLINCISNFIYLFP
DVAQDMIGHLLSMLHDTDYRVRLYLARKIVVLFQIWEGHSELFHDVCSSIGVKMVQFSNE
NPVRAREVLAIGPQPVPIIETALITLAHLSLQSEDIEVECVFMISAVAAIEPSQRELTYA
LFDSVSKRLNYASRSKYLDQLIGPILFRWVACEVSLVSLVEVKEMFGFKSDEPKNFIEHC
CSWLLSFLILRGETADLNWLSKILSQPLSAVIKGYFVPIFGLCIAARYGSGPEKDLAETV
LCESLLQLGEISEPERDDLIKKHMVSIVGFLLSVSSSSRQPEIPHFSKEAVAHSVKTVVD
GFMDAMDGNLAETVVIDKINIFRSDRVFKFLLAIHQQIADASHPRHIRHRLCAIEVLIDV
LGHRVALYSTWFYIICIVGSYIQRQPLQDQCCNILSKLLAAFNSNCSTETDAALGKQLQL
LVPKLVTCCLRNEKGGKGAIADSSRVLSLLRQLTVDADPLLYDYIRDLEPLPSFDCLKDI
QVFHASLSGSYDSRDQFLKFVSRAPHLPPELFLLSLRMHHKKLLLGEIIYRGDVSVDNAD
TISCWHSDPDVVSAVWTLVDLCSSSSVANEASSVLADFISRAGISDVHQVIFHVPNLTEK
YPIQPHISKEDKLPSDYGISDDILVGLLKLLKACLSDESAEIIDVTSRTLRGVLSTARGL
NALHCLDSLDRSLLMVHSRGINAQVVEQTLLGMEKVSGVSLEDSDLWRTDGRTYKQWLCT
LVGSLICHCDDIILRLCRSIAFLKVEVAELLLASALVNIAGNLDSNAGICRLISSMVEEK
IFCDSNHLMKSVYLFLDALNVVRSYYVAEKARGCPSNTLKDGRSVRSKSRSPTTTPSSSW
KKVYWLSVDYLVAARAANRCSCDFATLMYVELWCEEKFNMLALGPPDFSHEESLPPHIDL
LVASFTRINELDSIYGITLANEITSQIIRYEHEGDWSSALEYHDLLVRSTRKENHGSLAG
TALTGPSDVPSKAEEKMLNWQMHKGLMRSLQKTGCSHVLDVYCQGLSNQKSCLQQDSEFI
DMQYEAAWRAGNWDFSFFIPYSSQPSTHSQSYCLFNGNLHSCLRALQNGDSEEFHVKLSN
SKMDLVLALSNASKESTKYIHSTVIKLQMLDHLTMAWDLRWKFCLNQTSKSYVGNKDFSP
VPTVPTRMQLELLNKEWTFILCQTERNLDLLEPFLAFRSAVLKILGSEEHLREHLFQSAS
ALRKGARFSLAAAALYELKELRYHMDHQAMPNSYFLFKLEEAKLLRAQGQHDMAINLGKY
ILKNHPDKKNVSDVYRLVGKWLAETRSSNSRTIIDDYLRHSVDFTELHKCPDKKYKSRQC
RTYFHLAHYTDGLFKSYEERLSSNEWQAALRLRKYKSKELDTLMKRLKSSSKSEKTDYSV
KIQELQKQLALDEEEAGKIQDDRDKFLNLALQGYQRSLVVGGKYDLQVVFRLVSLWFSLF
SREQVVKAMMKTTKEVQSYKFIPLVYQIASRLGSSKDAQGSTNFQNALASLLKKMAIDHP
YHTIFQLLALANGDRVKDKQRSRSSFIVDMDKKLAAENLLKDLSSSHGALIRQMKQMVEI
YIKLAELETKKEDTNKRIPLPREIRSICQLELVPVVTASIPVDPNCQYEEGSFPHFNGLA
DSIMVMNGINAPKVIECIGSDGNKYRQLAKSGNDDLRQDAVMEQFFSLVNMFLQNHRDTS
ERRLRIRTYKVVPFTPSAGVVEWVNGTVPLAEYLVGSTRSGGAHGRYGTGDWTYHQCRET
MTNEKDKRRAFVKVCNNFRPVMHHFFLERFLQPADWFQSRLAYTRSVAASSMVGYIVGLG
DRHSQNILIDQETAEVVHIDLGVAFEQGLMLKTPERVPFRLTRDMIDGMGVTGVEGVFRR
CCEKTLSVMRANKEALVTIIEVFVHDPLYKWALSPLKALQRQKESEDIDSCLDDSQEACE
GNKDAARAILRVKQKLDGYEDGEMRSVQGQVQQLIQDAVDADRLCQMFPGWGAWL
NT seq 8988 nt   +upstreamnt  +downstreamnt
atggcgacctcccgcgacgccgatgagatcatcgagaagctctcctccgaccgggccaga
acccgcgatgagggggtgaagctgctgggcacctggctgcaaggcgaccgcgccttctcc
ttctgccgcctcctcgcccgcaacaccgccaacctcaagcccgcccatctccccgcctcc
gccacatggcccttcctcatcatggcgctcaccaaatgcgtcatcgccgacatctccggc
aagaagcgctctcccaagagcgccgctgccaggatgctccgcctcgccgtccagtgcgct
caagacttccgcctctcagggcggtcgttacttttgatttccgtcgctaagaaacttttc
agtcatatatgggaggttgtaaaagatgctcccagctttctgatagagtacagcataatt
cttaggcagcttttaactgttaaggagtaccggtatcagatgaaacctcgaacatatagc
agttttgttgtgctctacatgaagaaagttgcgactggttttgatgaaaaaatcagtaat
caggccagctccaaggaggaatccttccgttgtacactgacccttcacgttctacttgaa
aacccaccgggtgattaccctgatatcatgagggaggaggtcctttgtgggttttgtgca
atatgctcaaatattagggaagagggaaagctgacccgcaaacttatagaatgcgttaac
acctttctactgaaggatgggccaaacctgggatgcaaatctgttgatatccataatgct
gttcaagattttatgttccattcttggcctgtgacccacgacagggctttgaagagcttg
ttcatcacctatgcaaaggttcagctggaacttgctagggctattcctgagattttggaa
aaacttcttgatgtcatcattaaggaattagaccaaaattttaatactggagccggttta
gtatggtgcgaggcacctcgagacgagaaagctggctccttgaggtgcttccaggaagaa
ttgatggatctatctgctactgccttatatctggcctacaaatgcacaccgaggacatca
cataacaagaaaaagttaaagacggagcatgttatgaccgccatcatggatagcctgctg
agaggatcccttgtttggagtggttctatttgttgtcttattcacaagtatgggtaccga
gtggataaatctttgttgatcaattggttcaaggcgacctgtaagggtttgaaaagtgtt
ttgagcaatgcaaatgccctacggtttcaagattcactgctttggcttatcagggttctc
aaggagttctctgcgcttctcatgtctagtgctagggatgcaccaccattttggttaaca
aatgacgagatgtcaattttggaaggttattggcaagatacctggaattctcttattcac
gcacttcctttgtttagcaccacagctctagtcgttgattcagttctgaggttgttgggt
gaaatgatcatgcgggaccaagttcatgcatcatttgtgtcagaagatacatgggaccta
caaatatttaaacaattaccatcatcgtctactctgtacttcattgcttgttacttttca
aagataggttttcagggcgatgtatccaattccatatttattagaaagaatctgttaaga
tcaacttttgagttagtgcactccaagggtttctctcttttgaatgaacaaagtgttctg
atgattcctgaaaccattttttctctctgtgctggtttttcctcgccagtgattaactca
gcagatacatcgcaactgtttggtgaatgtaaaaacttatctaaggacaagtgctggtct
cacgaggaagaactaggttattctgtggaaactctatcggagatcaatctggaaagtcct
accaaggccatgtctgagaaatgcagccgagcgcaccttcctcggcatattcagcaaccc
ttgctcctggagcttctagagttcaccaaaggattcatgtcctcaaataaacagtttgag
aaagtggacttacctaatcttgtttatgcctgctctctagtctgcaatctaattcattgt
tcgctgttgtcaagggtctttgaagaaaaatcttcttttctgcaagttatgttggattat
gtcaccaatgccataaaacatattgtgtcagtggttatgaaggaacatgctgaactttct
catggtcttaccaatctaggatcagtatttgacacaactggctcagccttatcctcattt
aagagcttcatgcattctccattatttagtctgtggagagttaataacaaaactagttct
gtgcttggtgtcaccgaattacttgatgaactcttagaggcaatttctgagctatttgct
cagttctctagtttgatgaacaattttgatggagacaatcctagtaaaatgttgccagtg
ccttttgtcagtttgtcagaggacctacatcctgacaacagaagtagttttgttgatatg
gatcttgatatgactggctctggtgaagtagatcctgtcacagcaggtggaagtggaagt
atgggtatctcaccacggcctttggagtgcaagctagaactagtctgtattatttcaact
tttttctctgttgtgccgcttcatacctgggaagtcttgtacaacttagctgacaaagag
gtcaatatcaaggttggccaggctatcttgcttgaactttgcacaaatatctctgcctca
tcaagtagtttatcttctgtgctcaatcttgtagttgatatgtgggaaagaagtgcttgt
acactacttagctctgcagattgtttagcacatgtccatgccttgctaaggaatttgaca
gctaattgtgatgttgggcataatactgatggaaggtcacaaggatgtaaagtggcatcc
aatgagaaccaggatgtcttcttagacttactaaacaaggctacagagatcagtttcaca
gattggtttttccgcatcaggctgattaattgcatctccaactttatttatctgttccct
gatgtcgcacaggacatgattggtcatttgcttagcatgctgcatgatactgattaccgt
gttaggttgtatttggctcggaaaattgttgtgctattccaaatatgggaaggacacagc
gagttgttccatgatgtttgctccagtattggtgtcaagatggtgcagttttcaaatgaa
aatccagttagagctagagaagtgttggctattggtccacagcctgttcctattattgaa
actgctctgattacactagctcatttgtccttacaaagtgaggatattgaggttgagtgt
gtattcatgatttccgctgttgctgctatagagccttctcagcgagaattaacttatgct
ctatttgattctgtctcaaagaggctcaattatgcttcacgaagtaagtatttggaccaa
ctgataggtccaattcttttccggtgggttgcttgtgaagtgagcctagtttcgcttgtt
gaggtgaaagaaatgtttggctttaaatcggatgagccaaagaacttcattgaacattgc
tgctcatggttactttctttccttattctgaggggtgagactgccgatcttaattggcta
tccaagattttgtctcaacctttgtctgctgttataaagggatactttgtcccgatcttt
ggattgtgcattgctgccagatatggctcagggccagaaaaggacttagcagagactgtc
ttatgtgaatcccttttgcagcttggtgaaatttctgagcctgagcgcgatgatctcatt
aaaaaacatatggtttccatagttggctttttgctatcagtttcatcttcttcacgtcag
ccagaaatcccacacttctccaaggaggctgtggcacactcggtgaaaacagttgttgac
ggatttatggatgcaatggatggtaatttggctgaaacagttgttattgataaaatcaat
atattccgttcagacagggtttttaagtttctgttggcaatacatcagcaaattgcagat
gctagccatcctaggcatattcgccatcggctttgtgccattgaggttttgatagatgta
cttgggcatagagtggctctttacagcacttggttctatattatttgtatagtggggagt
tacatccagagacaaccattgcaagaccaatgctgcaatatcttgtccaagttgttggct
gctttcaattcgaactgttctactgaaactgatgctgcgcttggcaagcagcttcagctc
ttagttccaaaattggtcacttgttgccttcgtaatgagaagggagggaaaggtgctatt
gcagactcatcaagagttttatctttgcttcgtcaattgacagttgatgctgatccattg
ctttatgattacataagagatttggagccacttcctagctttgattgcttaaaagatata
caagtgttccatgcttcactttctggttcctatgattcaagagatcagtttctaaagttt
gttagcagggctcctcacttgccaccagagctgtttctgctgagtcttcgtatgcatcac
aagaagttattattgggagagatcatatatagaggcgatgtatctgtggataatgcagac
acaattagctgttggcacagtgacccggatgttgtttctgctgtatggactcttgttgac
ctctgtagctcatcgtctgtggcaaatgaagcttcatcggtgcttgctgattttatttct
agggctggcatatctgatgtgcatcaagtgatatttcatgtgccgaatcttactgaaaag
tatcccatacaaccacatatttccaaggaggataaattgccctcggactatggcatttct
gatgatattttggttggtcttctgaaacttttgaaagcttgtttgtctgatgagtcagct
gaaataatagatgttacttcacggacactgaggggagttctgtcaacggcaaggggtctg
aatgctctgcattgccttgattctcttgataggtctttgctgatggttcattcacgaggc
ataaatgctcaggtagttgaacaaacacttttgggcatggaaaaggtttctggtgtttca
cttgaagattcagatttatggagaactgatggtcggacttacaagcaatggctatgcacc
ttggtgggctcactaatttgtcattgtgatgacatcatcttgagactttgtaggagtatt
gcttttctcaaagttgaggttgctgaacttttgcttgcaagtgctcttgtgaacattgcg
ggcaatttggattcaaatgctggcatctgcagattaatttcatctatggtggaggaaaaa
atattttgtgactccaatcatttgatgaagtcagtttatctgtttttggatgcgctgaat
gttgtcaggtcttattatgttgcagaaaaagccagaggttgcccttcaaatactctcaag
gatggtagatctgttagatccaaaagtcgatcaccaaccaccaccccatcatcctcctgg
aagaaggtgtactggctttcagttgattatcttgtggctgccagagctgctaataggtgc
tcatgtgactttgcaacactaatgtatgttgagctttggtgtgaggaaaaattcaatatg
ctagcattaggacctccagatttttcgcacgaagagtcgttgcccccacatattgatcta
ctggttgcttcatttactcgcataaatgagctggacagcatttatgggatcacactggcg
aatgagataacttcacaaatcattagatatgagcatgagggtgattggagtagtgctctt
gaatatcacgatttacttgtaagatcaactcgaaaggagaaccatggcagtttggctggg
acagcattgactggaccatctgatgtgccttctaaagctgaagagaagatgctgaactgg
caaatgcacaaaggtctgatgagatctttgcagaagactggatgtagtcatgtccttgat
gtctactgccaaggtttaagcaaccaaaaaagttgtcttcaacaagattcagaatttatt
gatatgcaatatgaagctgcttggagagctggaaattgggatttctcctttttcattcca
tactcttctcagccttctacccattcccaaagttactgccttttcaatggaaatttgcac
agttgcttaagagctctgcagaatggtgattccgaggagttccatgtgaagctttctaac
tccaagatggatcttgtgctggctctttcaaatgctagcaaggagagcacaaaatacatc
cattctactgttatcaaactacagatgttagatcatcttactatggcttgggacctacga
tggaaattctgtctcaatcagacatcaaagtcttatgttggaaacaaggatttttctcca
gttccaactgttcctacaaggatgcagttggaactgctgaataaagagtggactttcatc
ctgtgtcaaacagaacgtaaccttgaccttttggaaccttttctagcattccgcagtgcc
gtccttaagatcttaggttctgaagagcatctcagagaacatttatttcaatctgcttca
gcactccggaagggagcaagattttctttggctgcagctgctttatatgaactcaaagaa
cttcgttaccacatggatcatcaagctatgccaaattcttatttcctatttaagcttgaa
gaagctaaactgctgagagctcaagggcagcatgatatggctataaatcttgggaaatac
attctaaagaaccatcctgataagaagaatgtatcagatgtctatcgattagtcggcaag
tggttggctgaaacaagatcgagcaattcaagaactatcattgatgactacctaaggcat
tccgtagattttactgaattgcacaagtgcccagacaaaaagtacaagtctaggcagtgc
cgaacatatttccatctagcgcattacacagatggcttattcaaaagctatgaggaaaga
ctttcatccaacgaatggcaagcagctctgcgattaagaaaatacaagtctaaggagctg
gatacactgatgaaaagacttaaaagttcatcaaagagtgaaaagactgattactcagtg
aaaatccaagagttacagaaacaacttgcacttgacgaagaagaggcagggaagattcag
gatgatcgggacaaattcttgaatctagcgcttcaggggtaccaacgctcactcgttgtc
ggtgggaaatatgatctacaagtggttttccggttggtctcactatggtttagtcttttc
tcaagagagcaagttgtgaaagcaatgatgaaaacaacaaaagaggtccagtcctacaaa
ttcataccattggtctatcaaattgcttctagacttggtagctcaaaagatgcgcagggc
tcaacaaacttccagaatgcgctagcttctcttctgaagaaaatggccattgatcatcct
tatcatacaatatttcagcttttggctctagcaaatggtgaccgcgtcaaagacaagcaa
aggagtagaagttcttttattgtagacatggacaagaaacttgctgctgaaaatctgtta
aaggatttatcttcttctcatggagctttgattcgtcagatgaagcaaatggttgagatc
tacattaagttggctgaactagagaccaagaaggaggacacgaacaaaagaattccacta
cctagggagatccgcagcatttgtcagcttgaacttgttcctgttgtaactgctagtatt
ccagtcgatcctaattgtcagtatgaagaaggttcctttccacattttaatgggctagca
gattctattatggtaatgaatggaattaatgctccgaaggttattgaatgtattggctct
gatggtaacaaatatcgccaactcgcaaaatctggaaatgatgacctgcgacaagatgct
gtgatggaacaatttttcagtctagtaaatatgttcttgcaaaatcacagagatacatct
gagaggagattgagaattcgcacatataaggttgttcccttcaccccaagtgctggtgtt
gttgaatgggtaaacgggactgttcctcttgctgaatatcttgtgggaagtacaagaagt
ggtggagcacatggaagatatggaactggagactggacatatcatcaatgcagggagacc
atgacaaatgaaaaagacaagaggagggcgtttgtcaaagtctgcaacaacttcaggcct
gtgatgcaccacttcttccttgagagattcttgcagcctgcagattggttccaaagtaga
cttgcttacacaagaagtgtggcagcaagctcaatggtaggatatattgtgggacttgga
gatcgtcattcccagaatattctcattgatcaagagacagctgaggttgtacacatagat
cttggtgttgcatttgaacagggtctcatgcttaaaactcctgaacgggttccatttcgc
ctgacgagggacatgatagatggcatgggagttactggcgttgaaggtgtatttagaagg
tgttgtgagaaaactctttcggtcatgagggcaaataaagaagcgttggtcactattatt
gaagtcttcgtccatgatccgttgtataaatgggctctttcaccactgaaggctttacag
cgtcaaaaggaaagtgaagacattgactcgtgcttggatgactcgcaagaggcttgcgag
ggcaacaaggatgcagcccgagctatcctccgtgttaagcagaaactagatggatatgaa
gatggtgaaatgagaagtgtacagggccaggtgcaacaactgatacaggatgcagtagat
gcggaccggttgtgccaaatgtttccagggtggggagcatggttgtaa

DBGET integrated database retrieval system