KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326227
Entry
4326227           CDS       T01015                                 
Name
(RefSeq) probable U6 snRNA-associated Sm-like protein LSm4
  KO
K12623  U6 snRNA-associated Sm-like protein LSm4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4326227
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4326227
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4326227
   03041 Spliceosome [BR:osa03041]
    4326227
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4326227
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4326227
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    4326227
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 4326227
NCBI-ProteinID: XP_015623140
UniProt: Q9LGE6
LinkDB
Position
1:complement(8570846..8574550)
AA seq 147 aa
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDKFWRMPECY
IRGNTIKYLRVPDEVIDKVQEETSKSRSDRRPPGVGRGRGRGDIGTKPGGRGIGRGQDDG
GSKGGGGRGRGGIGGKGGIKGGGRGRG
NT seq 444 nt   +upstreamnt  +downstreamnt
atgcttccgctctcgctcctcaagaccgcccaggggcatcccatgctcgtggagcttaag
aacggcgagacgtacaacgggcacttggtgaactgcgacacgtggatgaacatccacctc
cgggaggttatttgcacctcaaaggatggtgataagttttggaggatgccagaatgttac
atccgtgggaacaccatcaagtatcttcgggttcctgatgaggtgattgacaaggtccag
gaagagacttcaaagagcagatcagataggaggccaccaggtgtaggccgcggaagagga
agaggtgatataggtactaagcctggaggcagaggcattgggcgtggccaggatgatggt
ggcagcaaaggcggtggtggccgtggaaggggaggaattggaggtaaaggtggcatcaaa
ggtgggggccgcggacgtgggtga

DBGET integrated database retrieval system