KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326346
Entry
4326346           CDS       T01015                                 
Name
(RefSeq) carbamoyl-phosphate synthase large chain, chloroplastic
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4326346
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4326346
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     4326346
SSDB
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS Dala_Dala_lig_C ATP-grasp ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATP-grasp_5 RimK
Other DBs
NCBI-GeneID: 4326346
NCBI-ProteinID: XP_015617454
UniProt: B9EXM2
LinkDB
Position
1:21892773..21897928
AA seq 1172 aa
MATSLSSAPTQLRPSPSPSHHRLLHRSSLLPFPRRHHHRRRRCGALSIARASASAKDGVT
VRRFPAAPTEGGRLAGVRKIMILGAGPIVIGQACEFDYSGTQACKALAEEGYEVVLVNSN
PATIMTDPDLAHRTYIGPMTPPLVERIIAAERPDALLPTMGGQTALNLAVSLADSGALDR
LGVRLIGASLPAIRAAEDRQLFKQAMDRIGLKTPPSGIGTTLEECISIAEDIGEFPLIVR
PAFTLGGTGGGIAYNRAEFEDICRAGLAASHTQQVLVEKSLLGWKEYELEVMRDMADNVV
IICSIENIDPMGVHTGDSITVAPAQTLTDKEYQRLRDYSVAIIREIGVECGGSNVQFAVN
PADGEVMVIEMNPRVSRSSALASKATGFPIAKMAAKLSVGYTLDQIPNDITKKTPASFEP
SIDYVVTKIPRFAFEKFPGSEPVLTTQMKSVGEAMALGRTFQESFQKAVRSLETGFAGWG
CAPIKELDWDWEKLKYSLRVPNPDRIHAIYAAFKKGMRIQDIHEISFIDKWFLTELKELV
DVEQFLISRGLDQLSKDDFYQVKRRGFSDTQIAFATSSSETDVRLRRLALEVAPTYKRVD
TCAAEFEANTPYMYSSYEYECESVPTNKKKVLILGGGPNRIGQGIEFDYCCCHASFALRE
AGYETIMMNSNPETVSTDYDTSDRLYFEPLTVEDVTNVIDLERPDGIIVQFGGQTPLKLA
LPIQQYLEDKKLVSASGTGLVKIWGTSPDSIDAAEDRKRFNAILEELGIEQPKGGIARSE
SDALSIASEVGYPVVVRPSYVLGGRAMEIVYNDEKLIKYLATAVQVDPERPVLVDKYLID
AIEIDVDALADSVGNVVIGGIMEHIEQAGIHSGDSACSLPTRTVSAKCLDIIRSWTTKLA
KRLNVCGLMNCQYAITTSGEVFLLEANPRASRTVPFVSKAIGHPLAKYASLVMSGVTLPE
LGYTQEVVPKHVSVKEAVLPFEKFQGCDILLGPEMRSTGEVMGIDYEFSGAFAKAQIAAG
QKLPLNGTVFLSLNDLTKRHLAEIGRGFRELGFNIIATSGTAKVLQLEGIPVEPVLKIHE
GRPNARDMLKNGQIQVMVITSSGDALDSKDGLQLRRLALAYKVPIITTVDGARATIDAIK
SLKNKSIETLALQDYFQTTDASQNLQAAQSAS
NT seq 3519 nt   +upstreamnt  +downstreamnt
atggccacctccctctcctccgccccgacccagctccgcccctccccgtccccctcccac
caccgcctcctccaccgctcctccctcctccccttcccccgccgccaccaccaccgccgc
cgccgctgcggcgccctctccatcgcccgcgcctccgcctccgccaaggatggcgtcacg
gtgcggcgcttcccggcggcgccgaccgagggcgggaggctggccggggtgaggaagatc
atgatcctcggcgccggccccatcgtgatcgggcaggcgtgcgagttcgactactccggg
acgcaggcgtgcaaggcgctcgccgaggagggctacgaggtggtgctcgtcaactccaac
ccggccaccatcatgaccgaccccgacctcgcccaccgcacctacatcggccccatgacg
ccgcccctcgtcgagcgcatcatcgccgccgagcgccccgacgcgctgctcccaaccatg
ggcggccagaccgctctcaacctcgccgtctcgctcgccgactcgggcgccctcgaccgc
cttggcgtccgcctcatcggcgcctccctcccggccatccgcgccgcagaggaccgccag
ctcttcaagcaggccatggaccgcatcggcctcaagacgccgccctccggcatcggcacc
acgctcgaggagtgcatctccatcgccgaggacatcggggagttcccgctcattgttcgc
ccggccttcacgcttggtggcaccgggggaggcatcgcgtacaatcgggccgagttcgag
gacatttgccgtgccgggctggcggcgtcgcacacgcagcaggtgcttgtggagaagtcg
ctgctcgggtggaaggagtacgagctggaggtgatgcgcgatatggctgacaatgtggtc
atcatttgttcaattgagaatattgatccaatgggcgtgcatacgggggattccatcacg
gtcgcgcccgcgcagacgctcaccgacaaggagtaccagaggctcagggactactccgtg
gcgatcatccgggagattggcgtggagtgtgggggttccaatgtgcagttcgcggtgaac
cctgccgatggggaggtgatggtgattgagatgaaccccagggtgtcgaggtcatcagct
cttgcatcaaaggcgacagggtttccgattgccaagatggctgcaaagctctctgtaggt
tatactttggaccagattccaaatgatattacgaagaagactcctgctagctttgagcct
tccattgactacgtggtcactaagattccacggtttgcatttgaaaagttccctgggtct
gagccagtattaaccacacagatgaagtctgttggtgaggccatggctctaggacggacc
ttccaggagtctttccagaaggctgtccgttcattggagactggctttgcaggatggggt
tgtgcacccatcaaggaacttgactgggactgggaaaagttaaaatatagtttacgggta
cctaacccagatcggattcatgctatttatgcagcttttaagaaaggcatgaggattcag
gatatccatgaaattagctttattgataaatggttccttactgagctcaaggagctagtg
gatgttgagcaattccttatttcaaggggcctagatcagctgtcaaaagatgacttctat
caagtgaagcggaggggttttagtgacacgcagattgcctttgcgacatcttcttcagaa
actgatgtgagattaaggcgcctggcactagaagttgctccaacatacaagcgggttgat
acttgtgcggctgagtttgaagccaatacaccttacatgtattcctcgtatgagtatgaa
tgtgagtctgttccaactaataagaaaaaggtgttgattttgggtggcgggcccaatcgg
ataggccagggtattgagtttgattattgttgttgccatgcttcatttgcccttcgagag
gctggatatgaaactataatgatgaactccaacccagagacagtttcaactgactatgat
accagtgaccgtttgtactttgagccattaacggttgaggatgtaaccaatgttattgat
ttggaacgcccagatggtataattgtgcagtttggagggcaaactcctctcaagcttgcg
cttcctatacaacagtatctggaggacaagaagctggtgtctgcctcaggcactggactt
gtgaagatatgggggacctcaccagattctattgatgctgctgaggacagaaaaagattt
aatgctatacttgaagagcttggaattgagcagcctaaaggagggattgcaagaagtgaa
tcggatgccttgtctattgcctcagaagttggttaccctgttgttgtccggccttcgtat
gttcttggtggccgagctatggagattgtgtacaatgatgagaaacttattaaatacctc
gcaactgcagtgcaagtagatccggagcggcctgtcttggtggataaatatctaattgat
gcaattgaaattgatgttgatgcattggctgactcagttggtaatgttgtgattggtgga
attatggagcatattgagcaggctggtatccattctggtgattctgcctgttcccttccc
actagaacagtctctgcaaagtgtttagatataatccgttcatggaccacaaagctggca
aagcgtctcaacgtctgtgggctcatgaactgccagtatgctattactacttctggtgag
gtattccttcttgaggcaaatccccgagcctcacgcactgtcccttttgtctcgaaagca
attggacatccattggcaaaatatgcatctctggtcatgtctggtgtgaccttgccagag
cttgggtacactcaggaagttgttcctaagcatgtttctgtcaaggaggcagttcttcca
tttgagaaattccagggctgcgacattcttctgggaccagagatgcgcagcaccggagag
gtgatgggcattgactatgagttttctggtgcattcgcaaaggctcagattgccgctgga
cagaagctcccattaaatggaactgtcttccttagtctaaatgacctgacgaaacgccac
cttgctgaaatcggacgagggttcagggaacttgggttcaacatcattgccacatctgga
acagccaaagtacttcagctggagggcatcccagtggagccagttctgaaaatacatgag
gggcggccaaatgccagggacatgcttaagaatggtcagatacaggtgatggtgataact
agctcaggtgatgctcttgactccaaagatggcctccagctccgcagattggccctggcc
tacaaggtcccgataattactaccgtggatggggcgcgtgctaccatcgatgctatcaaa
agcttgaagaacaaatcaattgagactctcgcattgcaagattacttccagactacagat
gcatcccagaacttgcaagcagcgcaaagtgcctcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330474
Entry
4330474           CDS       T01015                                 
Name
(RefSeq) carbamoyl-phosphate synthase small chain, chloroplastic isoform X2
  KO
K01956  carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa00250  Alanine, aspartate and glutamate metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4330474
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4330474
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     4330474
SSDB
Motif
Pfam: CPSase_sm_chain GATase Peptidase_C26
Other DBs
NCBI-GeneID: 4330474
NCBI-ProteinID: XP_015625687
UniProt: Q6YV23 A0A0P0VNK1
LinkDB
Position
2:29270055..29274403
AA seq 473 aa
MAAPPATASAPSLRPSAASPRAAAARSVAVPSGPRTVGPRRDGGRFLGVRAAKAVSGVQS
GTVVDDGVQRPWKLSDARLVLEDGSVWKAKSFGASGTQVGEVVFNTSLTGYQEILTDPSY
AGQFVLMTNPHIGNTGVNPDDEESNRCFLAGLIIRNLSICTSNWRCTETLEEYLMKRNIM
GIYDVDTRAITRRLREDGSLIGVLSTDQSRTDDELLEMAKNWKIVGVDLISGVTCDAPYE
WSDKTDSEWEFKKGQSTESFHVVAYDFGIKHNILRRLTSYGCKITVVPANWPASEVLNLK
PDGVFFSNGPGDPAAVPYAVKTVQEIIGKVPVFGICMGHQLIGQALGGKTFKMKFGHHGG
NHPVCDLRSGRVDISAQAFRITGVGRGAGLLAVTLPDENLELLRNHNYAVDPESLPEGVK
VTHINLNDNSCAGLQYPKMKLLSLQYHPESSPGPHDSDLAFGEFIEMMKNNRL
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcggcgcctccggccacggcctccgcgccctccctgcgcccgtccgcggccagccca
cgcgccgccgccgctcggtcggtcgccgtcccctcagggcctcgcaccgtcggcccgagg
cgagacgggggccgcttcctcggcgtccgtgctgccaaggctgtcagtggcgtgcagagt
ggtaccgtggtggatgatggagtgcaaagaccatggaagctcagcgatgctcggctcgtt
cttgaggatggttcagtttggaaggccaagtcttttggtgcttcaggaacacaagttggt
gaagtggtatttaatacatctttgacagggtatcaagagattttgactgatccaagctat
gctggtcaatttgtcctcatgaccaacccacatattggaaacactggtgttaatcctgat
gatgaagaatcgaaccgatgtttccttgctggtctgatcataaggaatctaagcatatgt
acatccaactggcgatgcacagaaacacttgaagagtatctgatgaagagaaacattatg
ggaatatatgatgtggacacacgcgccataacacggagattacgagaagatggtagtcta
attggtgtcttaagtactgatcaatctcggaccgatgatgagttgttggaaatggcaaaa
aattggaaaattgttggtgttgatttgattagtggtgtcacatgcgatgctccatatgaa
tggtcagacaagactgattcagagtgggaattcaagaagggtcaatcgactgaaagtttt
catgtggtcgcatacgattttggaatcaagcacaatattttgagacgtttgacgtcatat
ggatgcaagataactgttgttccagccaattggcctgcttctgaggtacttaacttgaag
cctgatggtgtgttttttagcaatggtcctggagatccagctgcagttccatatgctgtg
aagacagtacaagaaataatagggaaggttcctgtgtttggcatctgtatgggccaccaa
ttgattgggcaagctcttggtgggaagacatttaaaatgaagtttggtcatcatggagga
aatcatcctgtttgtgaccttcgaagtggacgtgtcgacataagtgcacaagctttccgt
attactggtgttgggagaggtgctggacttctcgctgtgacacttcctgatgaaaacttg
gagcttctgagaaaccataattatgctgttgacccagagtcacttccagaaggggtgaaa
gtaacacatatcaatctcaacgataatagctgtgccggccttcagtaccctaagatgaaa
cttttgtctcttcagtaccatccagagtcctcacccgggccgcatgattctgacttggct
tttggtgaatttatagagatgatgaagaacaacagattgtga

DBGET integrated database retrieval system