KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326441
Entry
4326441           CDS       T01015                                 
Name
(RefSeq) protein CHROMATIN REMODELING 8
  KO
K10841  DNA excision repair protein ERCC-6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    4326441
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4326441
   03400 DNA repair and recombination proteins [BR:osa03400]
    4326441
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    4326441
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      4326441
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII HDA2-3 AP1AR AAA_34
Other DBs
NCBI-GeneID: 4326441
NCBI-ProteinID: XP_015621784
UniProt: Q7F2E4
LinkDB
Position
1:151388..156511
AA seq 1187 aa
MEDDDDDQRLLHSLGVTSADIHDIERRIISQATTDPADSSGPTINGGHQPDDALAKLHHK
LRSVQIEIDAVASTIKGAKLKQPSGNKPHEHKGKDQPDHHGAGHLQQALAADRLTSLRKA
KAQIQKEILQSHPSPSASNRKDKMLAMLVQDEPRHKKPPVGPKNIVKRPMKTVTYDDDNN
FDAVLDGASAGFMETEREELIRKGLLTPFHKLKGFEKRVELPEPSHRQDDSAGQTEEAME
ASRIARVAQSLKQIAQNRPATKLLDSESLPKLDAPAAPFQRLGKPLKRPVSPSSDEQEKK
RPRNKTKRPLPGKKWRKANSIKESSLDDNDVGEAAVSVSDDDEDQVTEGSDELTDVTLEG
GLRIPGTLYTQLFDYQKVGVQWLWELHCQRAGGIIGDEMGLGKTVQVLSFLGSLHNSGLY
KPSIVVCPVTLLQQWRREASRWYPKFKVEILHDSANSSSKKSKRSSDSDSEASWDSDQEE
AVTCSKPAKKWDDLISRVVSSGSGLLLTTYEQLRILGEKLLDIEWGYAVLDEGHRIRNPN
AEITLVCKQLQTVHRIIMTGAPIQNKLSELWSLFDFVFPGKLGVLPVFEAEFSVPITVGG
YANATPLQVSTAYRCAVVLRDLVMPYLLRRMKADVNAQLPKKTEHVLFCSLTTEQRATYR
AFLASSEVEQIFDGNRNSLYGIDVLRKICNHPDLLEREHAAQNPDYGNPERSGKMKVVEQ
VLKVWKEQGHRVLLFTQTQQMLDIMENFLTACEYQYRRMDGLTPAKQRMALIDEFNNTDE
IFIFILTTKVGGLGTNLTGANRIIIYDPDWNPSTDMQARERAWRIGQTRDVTVYRLITRG
TIEEKVYHRQIYKHFLTNKVLKDPQQRRFFKARDMKDLFTLQDDDNNGSTETSNIFSQLS
EDVNIGVPSDKQQDQLYAASATPTTSGTEPSSSRHGQGKEDHCPDQADEECNILKSLFDA
QGIHSAINHDAIMNANDDQKLRLEAEATQVAQRAAEALRQSRMLRSHESFSVPTWTGRAG
AAGAPSSVRRKFGSTLNTQLVNSSQPSETSNGRGQSLQVGALNGKALSSAELLARIRGTR
EGAASDALEHQLNLGSASNHTSSSSGNGRASSSSTRSMIVQPEVLIRQLCTFIQQHGGSA
SSTSITEHFKNRILSKDMLLFKNLLKEIATLQRGANGATWVLKPDYQ
NT seq 3564 nt   +upstreamnt  +downstreamnt
atggaggacgatgacgatgaccaacgcttgcttcacagccttggtgtcacgtccgcagac
atccacgatattgaaaggagaatcatatcacaggcaacaactgatcctgccgactcatct
ggaccaaccatcaatggaggtcatcagcctgatgatgctctcgccaaactgcatcacaaa
ctgcgctctgtgcaaattgaaattgatgctgtagcctccaccatcaaaggagctaagctt
aagcaaccatccggaaataaaccacatgagcataaaggcaaggaccagccagatcatcat
ggagcaggacacctccagcaagcccttgctgccgaccgtcttacaagcctcaggaaagct
aaagcacagatacagaaagagatactacagtcacatccttctccatctgcctccaatcga
aaagataaaatgctggccatgctggtccaagacgagccgaggcacaaaaagccacccgta
gggcctaaaaacatcgtgaaacgcccgatgaaaactgtcacctatgatgatgacaacaac
ttcgatgcagtgcttgatggagcctctgcgggatttatggaaactgaaagggaagaactg
atcaggaagggtttgttgacaccattccataagttgaagggcttcgagaaacgtgtggaa
ctacccgaaccttctcatagacaagatgattctgcaggacaaactgaagaagccatggaa
gcttccaggattgctagagttgctcagtcgctaaagcagattgcacagaaccgcccagca
accaaattgcttgattcagagtctttacctaagctagatgcacctgctgccccatttcag
agacttggaaaacccctaaagcgtcctgtctctcccagttcagatgagcaggaaaagaag
agaccaagaaataagaccaaaagaccactgcctggcaagaaatggaggaaagcaaactca
attaaggaatcatcattggatgacaacgatgttggagaggcagctgtgtcagtttcagat
gatgatgaagatcaagttacagaaggctctgatgagttaactgatgttacccttgaagga
ggtttgagaattcctggcacactttacacgcaactatttgactaccagaaagtgggagtg
cagtggctatgggagttgcattgtcaaagggctggtggaataattggagatgaaatgggc
ctgggaaagactgtgcaggtcttgtcatttcttggttccttgcataacagtgggctctac
aagcctagcattgttgtttgtcctgtaacccttttgcaacagtggcgaagggaggccagt
agatggtatccaaagttcaaggttgagatcttacatgactctgcaaacagttcatctaaa
aagagcaagaggtctagtgattctgacagtgaagcttcctgggatagtgatcaggaagaa
gcggttacatgttcaaaacctgcaaagaagtgggatgacttgatttcacgtgttgtgagt
tcaggatcaggtttgcttctgaccacatatgagcagttaaggatcctaggggagaagttg
cttgatatagaatggggatatgctgtattggatgagggtcaccgcattaggaatcctaat
gctgagattactcttgtgtgcaagcaattgcagaccgtgcacaggataattatgacaggt
gcacctattcaaaacaaactttcggagctttggtctctctttgattttgtgttccctgga
aaactaggtgtcctgcctgtgtttgaggctgagttttctgttccaattactgttggtggg
tacgctaatgcaacaccattgcaagtgtccacggcgtatcgatgtgctgttgtcctacgt
gacctggtcatgccgtaccttcttagaagaatgaaagctgatgtcaatgcacagcttccc
aagaaaacagagcatgttcttttctgtagtctaactactgagcaacgtgctacttatcgt
gcatttcttgctagttcggaggtggaacaaatctttgatggtaacagaaattccctttat
gggatagatgttctaaggaagatatgcaatcatcctgatctacttgagagagaacatgct
gctcagaatcctgactatgggaatcctgaaagaagtggaaagatgaaagtggttgagcaa
gttcttaaagtatggaaagaacaaggtcatcgtgttcttcttttcactcagacacaacaa
atgcttgacattatggagaacttcttgacagcttgcgaataccaataccgaagaatggat
ggacttacacctgcaaagcaaagaatggcacttattgatgaattcaataacacagatgaa
atttttattttcattctgaccacgaaagttggtggactgggtacgaatttgactggtgca
aaccggattattatatatgatcctgactggaatccttcaactgacatgcaggctagggaa
cgtgcatggcgaattgggcaaactagagatgtgacagtttatagactgatcacgcgtggg
acaatagaggagaaagtctaccatcgtcagatatacaagcatttcctcacaaacaaagta
ctgaaagaccctcagcagaggcggttttttaaagccagagacatgaaggatttgtttacg
ctgcaagatgatgacaataatggctcaactgaaacatcaaatattttcagccaattgtct
gaggatgtgaatatcggagttccgagtgacaagcaacaagaccagctatatgcagcctct
gctacaccgacaacctctgggactgaaccgagctcatccaggcatggacagggtaaagaa
gaccattgccctgaccaagcagatgaagaatgcaacattttgaagagcctttttgatgct
caaggcattcatagtgcgatcaatcatgatgccataatgaacgctaatgatgaccagaag
ctgcgcctagaagcagaagctacacaggtggcacaaagggcagctgaagctttacgccaa
tcacggatgctcagaagtcatgaaagtttttctgttcctacatggactggaagagctggt
gctgcgggggcaccatcctctgtccgcaggaagtttgggtcaacactcaatacccagttg
gttaattcttctcagccatcagaaacttcaaatggcaggggccaaagtcttcaggtgggt
gctctaaatggcaaagcactgtcctccgctgagcttctggccaggatacgtggaacccga
gagggagcagcttcagatgcactagaacatcaactcaacctgggatcagcttccaatcac
acatcgagttcatcagggaatggccgtgcatcaagctcttctactaggagcatgatcgta
cagcctgaagtcctaatccgccaattgtgcaccttcatacagcagcatggtggttccgcc
agctcaacaagtataactgaacacttcaagaaccggatactgtccaaggatatgctgctg
tttaagaatctgctgaaggaaatagctacgttgcaaagaggtgcaaatggtgcaacgtgg
gtgctgaaacctgactaccagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326574
Entry
4326574           CDS       T01015                                 
Name
(RefSeq) protein CHROMATIN REMODELING 24 isoform X1
  KO
K10841  DNA excision repair protein ERCC-6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    4326574
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4326574
   03400 DNA repair and recombination proteins [BR:osa03400]
    4326574
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    4326574
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      4326574
SSDB
Motif
Pfam: SNF2-rel_dom RRM_1 ResIII AAA_34 RRM_7 Nup35_RRM Peptidase_C23
Other DBs
NCBI-GeneID: 4326574
NCBI-ProteinID: XP_015622070
UniProt: A0A0P0V5M9 Q5VNP2
LinkDB
Position
1:complement(25524181..25532037)
AA seq 469 aa
MVQIKELGEGSSHAGQVVIRGLPSELSYADLADYFIKYGKIVDLIIIRAKGTAQAGDSAK
ITYADAAISDKIIKCRHIIKGKHVVVDRTLMEDTIQYKDKKTNRRITLDGLPWTVSNDDI
VHFFSPYGTVVDHQITQKDENKLSEGSGFVLFSSELAVIKILSNGNTVNLGGEKVSINRS
GAFVIAATGHHIKHPFLLPSEIFSSLFPHQKDGLEWLWRLHCEKSGGGILADDMGLGKTR
QASAFLAGLFYSDLTQRVLIVAPGTILHQWIAELTKVGFNEDLIHSFWCAKTRHDSLAQV
LKEGGVLLITYDLVRLYNEELNGMSSKSSKMRRACPSWDYVILDEGHVLKNPNTKNAAAL
KSLSRGQTVVLTGTPVQNNLSEFHSLMSLCCPTVLGSLAAFERDFCKPIDMGNVLEATTE
VVMISSKKAMEFRKMVRPYFLRRTKESIESLLPNKADLVIWLKLTPYQI
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggtacagattaaggaacttggcgagggcagcagccatgctgggcaagttgttataaga
gggctgcctagcgaattgtcatatgctgacctagcagactatttcattaaatatggaaag
atagttgatttgattattatcagggccaagggcacagcccaggcaggggattctgctaaa
attacttatgccgatgctgccatttctgataaaataatcaagtgcaggcatattatcaaa
ggaaaacatgttgtagttgatagaacattaatggaagacaccattcagtataaggacaag
aagacaaaccggaggataactctggatggccttccctggacagtgtccaatgatgatatt
gtgcacttcttctctccatatggaacagtagttgaccatcagatcactcagaaggatgaa
aataaactttctgaaggatcagggtttgtgctcttcagttctgagctagctgtaattaaa
attctctcaaatggcaacactgttaatcttggtggtgaaaaggtgtctattaatagatca
ggtgcttttgttatcgcagcaactggacaccatataaaacacccctttctccttcctagt
gagatattttctagtctcttccctcatcaaaaggatgggcttgaatggctctggaggctc
cactgtgaaaaatccggtgggggaattcttgcggatgatatgggcctaggcaaaacccgc
caggcttcagcctttctagctggccttttttattccgatttgacacaaagggtattgatt
gttgccccgggcacaatcttgcatcagtggattgctgaattaacaaaagttggttttaat
gaagatcttatacatagcttctggtgtgccaagacaaggcatgattctctagcgcaggtg
ctaaaggaaggtggtgttctgcttattacgtatgatctggtgaggttgtataatgaagaa
ctaaacggcatgagcagtaaaagctcaaagatgagaagagcttgtccttcatgggactat
gtgattcttgatgagggtcacgtgctgaagaacccaaatacgaaaaatgctgctgcgctg
aaaagcttatctcgtgggcaaacagttgtcctcacaggaacaccggttcaaaataacctt
tcggaatttcattcactaatgagtctttgctgtcctactgtcttgggctctcttgctgct
tttgaaagagacttctgtaaaccaattgacatgggaaatgtgcttgaggcaacaactgaa
gtagtaatgatatcttctaaaaaggccatggagttccgcaaaatggtgcgaccttatttt
cttaggcgcaccaaggaaagtattgaaagccttttacctaataaagctgatcttgtcatc
tggctgaagctaacgccatatcagatataa

DBGET integrated database retrieval system