KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326457
Entry
4326457           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S5
  KO
K02989  small subunit ribosomal protein S5e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326457
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326457
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4326457
SSDB
Motif
Pfam: Ribosomal_S7
Other DBs
NCBI-GeneID: 4326457
NCBI-ProteinID: XP_015621158
UniProt: Q93VC6 A0A8J8Y851
LinkDB
Position
1:27126..28656
AA seq 200 aa
MAVVEQPQQQVVKLFNCWSFEDVQVNDISLADYLAVSSTKHATYLPHTAGRYSAKRFRKA
QCPLVERLTNSLMMHGRNNGKKIMAVRIVKHAMEIIHLLTDANPIQVIVDAIINSGPRED
ATRIGSAGAVRRQAVDISPLRRVNQAIYLLTTGARESAFRNIKTIAECLADELINAAKGS
SNSYAIKKKDEIERVAKANR
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcggtggtcgagcagccgcagcagcaggtggtgaagctcttcaactgctggtccttc
gaagacgttcaggtgaacgacatatccctcgccgactacctcgcggtgtcctcgacgaag
cacgccacctacctgccgcacacggctggccgctactcggcgaagcgcttccgcaaggcg
cagtgccccctcgtggagcgcctcaccaactccctcatgatgcacggccgcaacaacggc
aagaagatcatggctgtccgcatcgtcaagcacgccatggagatcatccacctcctcacc
gacgccaaccccatccaggtcatcgtagatgccatcatcaacagcggcccgcgtgaggac
gcaacccgtatcggctctgctggcgctgtgaggaggcaggctgtggatatctctcccttg
aggagggtcaaccaggcaatctacctcctcaccactggcgccagggagagtgcctttagg
aacatcaagaccattgctgagtgccttgctgatgagctcatcaatgccgccaagggctca
tccaacagctatgccatcaagaagaaggatgagattgagcgtgttgccaaggcgaaccgt
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350516
Entry
4350516           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S5
  KO
K02989  small subunit ribosomal protein S5e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4350516
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4350516
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4350516
SSDB
Motif
Pfam: Ribosomal_S7
Other DBs
NCBI-GeneID: 4350516
NCBI-ProteinID: XP_015617601
UniProt: A3CBA0 Q2R4A1
LinkDB
Position
11:complement(16917755..16919767)
AA seq 199 aa
MAEVELPQQEVKLFSRWSFEDVQVNDISLADYLAVNPTKHATYLPHTAGRYSAKRFRKAQ
CPIVERLTNSLMMHGRNNGKKIMAVRIVKHAMEIIHLLTDANPIQVIVDAIINSGPREDA
TRIGSAGAVRRQAVDISPLRRVNQAIYLLTTGARESAFRNIKTIAECLADELINAAKGSS
NSYAIKKKDEIERVAKANR
NT seq 600 nt   +upstreamnt  +downstreamnt
atggccgaagtggagctcccgcagcaggaggtcaagctcttcagccgctggtccttcgag
gacgtccaggtgaacgacatctcgctggcggactacctggcggtgaacccgacgaagcac
gcgacgtacctgccgcacacggcggggaggtactcggcgaagaggttccggaaggcgcag
tgccccatcgtggagcgcctgaccaactcgctcatgatgcacggccgcaacaacgggaag
aagatcatggccgtgcgcatcgtcaagcacgccatggagatcatccacctcctcaccgac
gccaaccccattcaggtcatcgtcgacgccatcatcaacagtggccctcgtgaggatgcg
acccgtattgggtctgcgggtgctgtgaggaggcaggctgtggatatctctcccttgagg
agggtcaaccaggcaatctacctcctcaccactggtgccagggagagcgccttcaggaac
atcaagaccattgctgagtgccttgctgacgagcttattaatgccgccaagggctcatcc
aacagctatgccatcaagaagaaggatgagatcgagcgtgttgccaaggccaaccgttga

DBGET integrated database retrieval system