KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326478
Entry
4326478           CDS       T01015                                 
Name
(RefSeq) poly [ADP-ribose] polymerase 2-B isoform X1
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4326478
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4326478
   03036 Chromosome and associated proteins [BR:osa03036]
    4326478
   03400 DNA repair and recombination proteins [BR:osa03400]
    4326478
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     4326478
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    4326478
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    4326478
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     4326478
SSDB
Motif
Pfam: PARP PARP_reg Enkurin
Other DBs
NCBI-GeneID: 4326478
NCBI-ProteinID: XP_015631445
LinkDB
Position
1:14034564..14041040
AA seq 378 aa
MDYGEADKETNKKTSSITNQLEETKLETRTASFISLICDISMMKQQMVEIGYNADKLPLG
KLSKSTILKGYDVLKRISNVISGADTDRTQLEQLTGEFYSVIPHDFGFKKMSEFIIDTPQ
KLKAKLEMVEALSEIEIAIKLLEDDSSDQDHPLYARYKQFCCDFTPLEVDSEEYSMIKTY
LTNTHGKTHTGYTVDIVQIFKVSRLGEMERFQKFASAGNRMLLWHGSRLTNWAGILSQGL
RIAPPEAPISGFMFGKGVYFADMFSKSANYCCASEACKSGVMLLCEVALGEMNELLYGDF
GADNLPNGKLSTKGVGQTEPNIAESKITDDGMVIPLGKPEKVPSRRGSLMYNEYIVYNVD
QIRMRYILNVNFNFKRWG
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggactatggtgaagctgataaagaaactaataagaagaccagttccattactaatcag
ttagaagaaacgaaacttgaaactcgaactgcaagcttcatatccctcatatgcgatata
agcatgatgaagcagcaaatggtggaaataggttacaatgctgacaagcttcctctggga
aagctaagcaaatctacaatacttaagggttatgatgttttgaaaaggatttccaatgtt
atttcaggagcagacacggacaggacacagcttgaacaattgactggagaattctacagt
gtgatccctcatgacttcggttttaagaaaatgagtgaattcattattgacactcctcag
aagctaaaagctaagctagaaatggttgaagcccttagtgagattgagattgcaatcaag
cttctggaggacgattcaagtgaccaggatcatccattgtatgcccgatacaagcaattt
tgctgtgactttacacctttggaagttgattctgaagaatactctatgataaaaacatat
ttgacaaatacccatggaaaaacacatacaggttatactgttgacatagtgcaaatattt
aaggtgtcaaggcttggtgaaatggagcggtttcagaagtttgctagtgctggcaatagg
atgcttttatggcatggttctcggctgaccaactgggctggtattctttctcagggtttg
cgaattgctcctcctgaagcacctatttcaggattcatgttcgggaaaggggtatacttt
gctgatatgttttccaagagtgcaaactattgttgtgcttcagaagcatgcaagtctggt
gtgatgcttctatgtgaggttgcacttggtgaaatgaatgaactactatatggagatttt
ggtgccgataacctgccaaatggaaaactaagtacgaaaggagttggccaaacagaaccc
aacatagctgagtccaagatcactgatgatggtatggttattccacttgggaaacctgag
aaggtaccttcgagaaggggtagcttgatgtacaacgagtacatagtttacaacgtggat
cagataaggatgcgttacatcctcaatgtcaacttcaacttcaagagatggggatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326479
Entry
4326479           CDS       T01015                                 
Name
(RefSeq) poly [ADP-ribose] polymerase 2-A
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4326479
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4326479
   03036 Chromosome and associated proteins [BR:osa03036]
    4326479
   03400 DNA repair and recombination proteins [BR:osa03400]
    4326479
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     4326479
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    4326479
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    4326479
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     4326479
SSDB
Motif
Pfam: PARP PARP_reg WGR SAP SAP_new25 CHU_C
Other DBs
NCBI-GeneID: 4326479
NCBI-ProteinID: XP_015630022
LinkDB
Position
1:14047770..14054908
AA seq 652 aa
MSARLRVEELRAELQRRGLDASGNKPVLVRRLDAAIRKEEEEEAAVSAAAKEEADAGGVV
DGEGNGEDKRKRKRRGDGEDVDNSESDAAKLEGMSYRELQALAKSRGLAANGSKKEVIER
LLCAPSDTDGGVQDKKKIAKDGDDRVEECRKEKIVTATRKGAAVLDQHIPDHIKMTYHVL
QVGDEIYDATMNQTNVGDNNNKFYIIQALESDAGGSFMVYNRWGRVGARGQDKLHGPFSS
REQAIYEFEGKFHGKTNNHWSDRKSFECYARKYTWLEMDYGEADRETNKKVSPSTDQIKE
TKLETRIASFISLICNISMMKQQMVEIGYNSDKLPLGKLSKSTIFKGYDVLKRISNVISR
ADRRQLEQLTGEFYTVIPHDFGFKKMREFIIDTPQKLKAKLEMVEALGEIEIATKLLEDD
STDQDDPLYARYKQLSCDFTPLEVGSEEYSMIKTYLANTHGKTHTSYTVDVVQIFKVSRH
GEMERFQKFATAGNRMLLWHGSRLTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFS
KSANYCYASEACRSGVLLLCEVALGEMNELLNADYDANNLPKGKLSTKGVGQTEPNTAES
KITDDGVVVPLGKPKAEPSKRGSLLYNEFIVYNVDQIRMRYVLHVSFNFKKR
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgtcggcgaggctgcgggtggaggagctccgcgccgagctgcagcgccgcggcctcgac
gcctccggcaacaagccagtgctcgtgcggaggctggacgccgccatccggaaagaggag
gaggaggaggctgcggtgtccgcagcagcgaaggaagaagcagatgcaggtggcgtggtg
gacggcgaagggaatggcgaggacaagaggaagaggaaaagacgcggtgatggagaggat
gtggataacagtgaatcggacgcggcgaagctggaggggatgagctatcgtgagctccag
gcactggccaagtcgaggggactcgcagcaaatgggagcaagaaggaggttattgagagg
ctgctctgcgccccttctgatacggatggtggagttcaggacaagaagaaaatcgcaaaa
gatggtgacgacagagttgaggagtgtagaaaggagaagattgttacagccacaaggaaa
ggtgctgcggttttggaccagcacatccctgaccatataaaaatgacctatcatgtcttg
caagtgggtgatgagatctatgatgccaccatgaaccagactaatgttggagacaacaat
aataagttctatatcatccaagccttagaatctgatgctggaggaagcttcatggtttac
aatagatgggggagggtaggggcacggggtcaagacaagctacatggtcccttttcatca
cgagaacaagcaatatatgaatttgagggaaagttccatggcaaaaccaataaccattgg
tcagatcgcaagagctttgaatgctatgcaaggaaatacacctggcttgagatggactat
ggtgaagcagacagggaaacaaacaagaaagtcagtcccagcactgatcagataaaagaa
acgaaacttgaaactcgaattgcaagtttcatatccctcatctgcaacataagcatgatg
aagcagcaaatggtggaaataggttacaattctgataaacttcctcttggaaagctaagt
aaatccacaatatttaagggttatgatgttttaaagaggatttccaatgttatttcgagg
gcagacaggagacagcttgaacaattgactggggaattctacactgtgatccctcatgac
ttcggttttaagaaaatgcgtgaatttattattgacactcctcagaagctaaaagctaag
ctggaaatggttgaagcccttggtgagattgagattgcaaccaagcttctggaggatgat
tcaaccgaccaggatgatccattgtatgctcgatacaagcaacttagctgtgactttaca
cctttggaagttggttctgaagaatactctatgataaaaacatatttggcaaatacccat
ggaaaaacgcacacaagctatactgttgacgtagtgcaaatatttaaggtgtcaaggcat
ggtgaaatggaacggtttcagaaatttgctactgcaggcaataggatgcttttatggcat
ggttctcggttgactaactgggccggcattctgtctcaaggtttgcgaattgctcctcct
gaagcacctgttactggctacatgtttgggaaaggagtatactttgctgatatgttttcc
aagagtgcaaattattgctatgcttcagaagcctgcaggtccggtgtgctgcttctatgt
gaggttgcactcggtgagatgaatgagctactaaatgcagattatgatgccaataacctg
ccaaagggaaagctaagcacgaaaggagttggccaaacagaaccgaacacagcagagtcg
aagatcacggatgatggtgtggttgttccacttggaaaacctaaggcagagccttcaaaa
aggggtagcttgctgtacaatgagttcatagtttataacgtagatcagataaggatgcgg
tacgttctccatgtttccttcaacttcaagaaacggtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329546
Entry
4329546           CDS       T01015                                 
Name
(RefSeq) poly [ADP-ribose] polymerase 3 isoform X3
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4329546
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4329546
   03036 Chromosome and associated proteins [BR:osa03036]
    4329546
   03400 DNA repair and recombination proteins [BR:osa03400]
    4329546
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     4329546
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    4329546
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    4329546
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     4329546
SSDB
Motif
Pfam: PARP PARP_reg PADR1 BRCT_2 WGR BRCT DUF4803 DUF5921
Other DBs
NCBI-GeneID: 4329546
NCBI-ProteinID: XP_015623193
UniProt: Q0E0Q3
LinkDB
Position
2:complement(19509826..19515175)
AA seq 831 aa
MVHETRSRTLAASQEEGKAAPKKQKTESKEQEGGQQAPSKNKKTADNEEHDGEQEPSKNK
KLKAEESDLNGKATAVKEFSEFCKAIREHLTIEDMRKILQGNEQDASGSEDAVVPRCEDV
MFYGPLDKCPVCGGQLECKGLKYNCTGTHSEWACCSFSTNNPSRRGGPIKVPDDVKNDFV
RKWLKQQEGNKYPKRNLDDEGIFSGMMIALSGRMSRSHGYFKEQIMKHGGKVNNSVIGVT
CVVASPAERHQGGSGGFAEALERGTPVVSENWIIDSVQKKEKQPLAAYDIASDVVPEGRG
LPLGNLDPTEEAIETLAAELKLAGKRAVHKDSKLEKDGGHIYEKDGIIYNCAFSVCDLGG
DINQLCIMQLIMVPENHLHLYYKKGPIGHDQMAEERVEDFGSRFNDAIKEFVRLFEEVTG
NEFEPWEREKKFKKKCMKMYPLDMDDGVDVRHGGVALRQLGAAAAHCKLDPSVTFIMKQL
CSQEIYRYALTEMGHDVPDLPIGMLTDLHLKRGEETLLEWKQDVESAPESGPAADAFWME
ISNKWFTLFPTTRPYTMKGYEQIADNVASGLETVRDINVASRLIGDVFGSTLDDPLSQCY
KKLGCSINRVVEDSEDYKMILKYLEKTYEPVKVGDVVYSATVERIYAVESSALPSYDEIK
KLPNKVLLWCGTRSSNLLRHLRDGFVPAVCHIPVPGYMFGKAIVCSDAAAEAALYGFTAV
DRPEGYLVLAVASLGKEIQEITGTPGSEDVKRMEEKKMGVKGVGRKTTDPSEHFTWRDGV
TVPCGKLVPSTNKDGPLEYNEYAVYDPKQVSIAFLVGVKYEEQNMEVVPDE
NT seq 2496 nt   +upstreamnt  +downstreamnt
atggtacacgagacaagatcacgcacactagcggcttcccaagaagaagggaaggctgct
ccgaagaagcagaagacagaaagcaaagagcaggaaggtggccagcaagcgccctccaag
aacaagaagacagccgacaatgaagagcacgacggggagcaggagccatcaaagaacaag
aagctcaaagcggaggaatctgacctgaatgggaaggcaacagccgtgaaggagttctct
gaattctgcaaggccataagggaacacctcacgatcgaggacatgcgcaagatcctccaa
ggcaatgaacaggatgcatctggatcagaagatgcagttgtcccaagatgtgaggatgtg
atgttttatgggcctcttgacaagtgccccgtatgcggtggtcagctcgagtgtaaggga
ttgaaatacaattgcactgggactcacagtgagtgggcatgttgtagcttcagtactaac
aatccttcgaggagaggtggtcctataaaggtccctgatgatgtcaagaatgatttcgtg
cgcaagtggctgaagcaacaagaagggaataagtaccctaaacgtaatttggatgacgag
ggtatcttctcgggcatgatgattgcattgtctggaaggatgtcacgctcacatggttat
ttcaaggagcagattatgaagcatggagggaaagtcaacaactccgtgattggtgtcact
tgtgtagtggcttccccagctgagagacatcaaggtggctctggaggatttgccgaagca
ctggagcgtggaactcctgttgtgagtgagaattggataattgatagcgtccagaagaag
gaaaagcaacctttggctgcttatgatattgcatctgatgttgttccagaaggccgaggg
ctgccgctgggcaaccttgatccaactgaggaggctatcgagaccttggctgcagagctt
aaacttgcaggcaaaagagcagtgcacaaagattctaaactggagaaagacggaggacat
atctatgagaaggatggcatcatctacaattgtgccttttctgtgtgcgatttaggaggc
gatattaaccagttatgcattatgcagctgatcatggtgcctgagaaccatttgcaccta
tactacaagaagggtcctattggacatgaccagatggcagaggaacgggttgaagatttt
ggtagtcgtttcaatgatgctatcaaggaatttgtccgtctttttgaggaggttactgga
aatgagtttgaaccatgggagagagagaagaaatttaagaagaagtgtatgaagatgtat
cccttggacatggatgatggtgttgacgtgcgccatggtggtgtggctcttcgtcagttg
ggagctgctgcagcacactgcaagcttgacccttctgttacttttatcatgaaacaacta
tgcagccaagaaatatacaggtatgctttgacagagatgggccatgatgtgccagacctt
cctatcgggatgcttacagatctccatctgaaaagaggggaggagacgctactagagtgg
aaacaagatgtcgagtctgctccagagtctgggcctgctgctgacgcattctggatggag
atcagcaataagtggttcaccctattccccacaactcgtccatatacaatgaagggatat
gaacagattgctgacaatgtggcttctggtttggagactgttcgtgatataaatgtcgct
tctcgtcttattggtgatgtgtttggttcaactttagatgacccactgtctcaatgctac
aagaaactaggctgttctatcaatcgtgttgttgaagactcggaggactataagatgatc
ctgaagtatctggagaaaacctacgagcctgtcaaggttggcgatgtggtttacagtgct
actgtcgagcggatatatgctgttgaatcgagtgctcttccttcttatgatgaaataaag
aaacttccgaacaaagttctcctctggtgtggaacaagaagttcaaatttgctcaggcac
ctgcgcgatggtttcgtgcctgctgtctgccatataccagtgccgggatacatgtttggc
aaagccatagtttgctcagacgcagcagccgaagccgcgctctacggcttcacggcggtg
gatcgtccggagggttacctggtcctggcggtggcatctctggggaaagagatccaggag
ataacaggcacgccaggctcagaggacgtgaaacgcatggaggagaagaagatgggcgtg
aagggagtcgggaggaagacgaccgacccgtcggagcacttcacctggagggacggcgtc
acggtgccgtgcggcaagctggtgccgtccacgaacaaggacggcccgctcgagtacaac
gagtacgccgtgtacgaccccaagcaggtgagcatcgcgttcctcgtgggcgtgaagtac
gaggagcagaacatggaggtggtgccggacgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343013
Entry
4343013           CDS       T01015                                 
Name
(RefSeq) poly [ADP-ribose] polymerase 1
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4343013
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4343013
   03036 Chromosome and associated proteins [BR:osa03036]
    4343013
   03400 DNA repair and recombination proteins [BR:osa03400]
    4343013
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     4343013
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    4343013
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    4343013
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     4343013
SSDB
Motif
Pfam: PARP zf-PARP PARP_reg PADR1 WGR BRCT BRCT_3 BRCT_2 PTCB-BRCT
Other DBs
NCBI-GeneID: 4343013
NCBI-ProteinID: XP_015647732
UniProt: Q7EYV7
LinkDB
Position
7:13026400..13037179
AA seq 977 aa
MAAPPKAWKAEYAKSGRSSCKSCRSPIGKDQLRLGKMVQATQFDGLMPMWNHASCILSKK
NQIKSVDDVEGIDTLRWDDQEKIRNYVGSAPATASSAAAISDKCTIEVAKSARTSCRRCG
EKIKKGTVRVSSKLEGQGWYHASCFLEMSPAATVENFSGWEILSHEDKRAVLDLVKKDAP
SSGQTSSKGSKRKNNQNDIHDCKAPKIIRSISEGTAEDKGKAVVSHDSNANSSDLQEKLK
EQSDTLWKLKDELKKHVSTAELRNMLEANGQDTSGPERHLLDRCADGMLFGALGTCPVCS
SFLYYHGGQYHCSGYVSEWSKCTYSTTEPVRSKKKWKIPDEMDNGYLTKWFKSQKAKKPE
RVLPPMSPEKSLCQSTQQNRSFLSEGLDKLRVSIVGQSKDVVDGWKQKLKDAGANFNATV
TKDSSCLVLCSELESENAEVKKARRLKIPILREGYLGECIRKNRVLPFDLYKVEAALESS
KGGTMTVKVKGRSAVHESSGLQDTGHILEDGKSIYNTTLNMSDLTRGVNSYYILQVIEED
NGSDCYVFRKWGRVGNEKIGGTKLEEMSKIHAIQEFRRLFLEKTGNPWEAWEQKTNFQKQ
PGKFYPLDIDYGVRQGPKRKDIDKMKSSLPPQLLELMNMLFNIETYRAAMLEFKINMSEM
PLGKLSKENIQKGFEALTEIQNLLGNTNNQELAVRESLIVAASNRFFTLIPSIHPHIIQD
EDDLMVKVKMLEALQDIEIASKLVGFDSDNDESLDDKYKKLRCAITPLPHDCEDYKLVEK
YLLNTHAPTHKEWSLELEEVFSLDRDGEFSKYSRYKNNLHNKMLLWHGSRLTNYVGILSQ
GLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRKNPVGLMLLSEVALGDMYELKKA
TSMDKPPRGKHSTKGLGKTVPLESEFAKWRDDVVVPCGKPVPASIKTSELMYNEYIVYNT
SQVKMQYLLKVRFHHKR
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggcggcgccgcccaaggcctggaaggcggagtacgccaagtccgggcggtcctcgtgc
aagtcgtgcaggtcccccatcgggaaggaccagctccggctcggcaagatggtccaggcc
acgcagttcgacggattaatgcccatgtggaaccatgccagttgcatcctcagtaagaaa
aaccagataaaatctgttgatgatgttgaaggaatagacacactcagatgggatgaccaa
gagaagataagaaattatgttggaagtgcaccagctactgcaagttctgcagctgctatt
tcagataaatgcaccattgaggttgctaaatctgcccgtacttcctgtagacggtgtggt
gaaaagataaaaaagggaacggttcgtgtttcatctaagcttgaagggcaaggttggtat
cacgccagctgttttctggagatgtccccagctgcaactgttgagaatttctcaggctgg
gagatcctgtcgcatgaggataaaagagctgttcttgatcttgttaagaaagatgccccc
agctcagggcaaacatcttctaagggttccaagcgcaagaataatcagaatgatatacac
gactgcaaagctcccaagataatcaggagtatatcagaaggcacagcagaagataaaggg
aaagctgttgtatcacatgattccaatgctaattcttctgatcttcaagaaaagcttaaa
gagcagagtgacacactttggaaattgaaggatgaacttaagaagcatgtgtcaactgct
gaactaaggaacatgctcgaagcaaatgggcaggatacatctgggccagagcggcatcta
ttagaccgttgtgctgatgggatgctttttggagcattgggtacttgcccagtttgttct
agcttcctatactatcatggtggccagtatcattgcagtggctatgtgtcagaatggtcc
aagtgtacatactctacgacagaacccgtgcgcagtaaaaagaaatggaaaattcctgac
gaaatggataatggttatcttacaaagtggttcaagtctcaaaaggctaagaaaccagag
agagttcttccgccaatgtcacctgagaaatcattgtgccaatcaacccagcaaaaccga
tctttccttagtgaaggactggataaattgagagtttctatagtaggacaatctaaagat
gtggttgatggatggaaacagaagctgaaagatgctggtgccaactttaatgccacagtt
accaaagacagcagctgcttagttttatgtagtgagcttgagagtgagaatgctgaagtc
aagaaagcaaggaggttgaagataccaattctgcgagaaggttaccttggagaatgcatt
agaaaaaacagagtgcttccatttgatttgtataaagtagaagctgcattggaatcttcg
aaaggaggcacaatgactgttaaagttaaagggcgaagtgctgttcatgagtcctctggt
ttgcaagatacaggtcatattcttgaagatggaaaaagcatatacaatacaaccctgaac
atgtctgacctgacacgaggtgtgaacagctattatatacttcaggtcattgaagaggat
aatgggtctgattgttatgtattccgaaagtggggacgagttgggaatgaaaaaattgga
ggcactaagttggaggagatgtcgaaaattcatgctattcaggaatttagaagattgttt
cttgagaagactggaaacccctgggaagcatgggaacaaaaaacaaatttccaaaagcag
cctgggaaattttatccacttgacattgactatggtgtaaggcaaggaccaaagcggaaa
gacattgacaaaatgaaaagttcacttcctccccagttgctggagctcatgaatatgctt
ttcaatattgaaacatacagggctgctatgctggaattcaaaattaacatgtctgagatg
cccctgggtaaactaagcaaggaaaatatccaaaaaggttttgaagcattaactgagata
cagaatctattgggtaacactaataatcaagaactggcggttagagagagcttgatcgtt
gccgcgagcaatcgtttcttcacccttattccttctattcatcctcacattatacaagat
gaggatgatttgatggtgaaagtgaaaatgcttgaagctctgcaagatattgaaattgct
tctaaacttgttggcttcgatagtgacaatgatgagtctcttgatgacaagtacaagaaa
cttcgatgtgccattacgccactccctcatgattgtgaagattacaagctagttgagaag
tatcttcttaacactcatgctcctacccacaaggagtggtcactggaattagaggaagtc
ttttcgcttgatcgagatggagaattcagcaagtactcaagatataagaataatctacat
aacaagatgttgttatggcatggttcaaggttgaccaattatgttggaatacttagtcaa
ggactaagaatagcacctcctgaggctcccgtgacaggctatatgtttgggaaaggcctc
tactttgcagatttagtaagcaagagtgcacaatattgttacgtggataggaagaatcca
gttggtttgatgcttctttccgaggttgctctaggtgacatgtatgaactgaagaaagcc
acgtccatggacaaacctccaagagggaaacactcgaccaagggcttaggcaaaaccgtg
ccgctcgagtctgagtttgcgaaatggagggatgatgttgtggtgccatgcggaaagcca
gtgccagcatctatcaagacatctgagcttatgtacaatgagtatattgtctacaataca
tcccaggtgaagatgcagtacttgttgaaggttaggttccatcacaagaggtga

DBGET integrated database retrieval system