KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326513
Entry
4326513           CDS       T01015                                 
Name
(RefSeq) S-formylglutathione hydrolase isoform X1
  KO
K01070  S-formylglutathione hydrolase [EC:3.1.2.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.12  S-formylglutathione hydrolase
     4326513
SSDB
Motif
Pfam: Esterase Peptidase_S9 Hydrolase_4 Chlorophyllase2 DLH Abhydrolase_1 Abhydrolase_11 Chlorophyllase DUF915
Other DBs
NCBI-GeneID: 4326513
NCBI-ProteinID: XP_015621309
UniProt: Q5JLP6 A0A0P0VCK9
LinkDB
Position
1:41251165..41272191
AA seq 292 aa
MAAAAPSPPPVAALEQMSRTKMFGGHNLRFRHHSATLGCPMTFSVFLPPSPASDLPVLYW
LSGLTCNDENFVTKAGAQRAAAAHGIALVAPDTSPRGLNIEGEADSWDFGVGAGFYLNAT
NEKWKNWRMYDYVVKELPKVLSDNFEQLNTSRASIFGHSMGGHGALTIYLKNTDKYKSVS
AFSPVVNPINCPWGQKAFSNYLGPAKSDWKEYDATCLIKKCNKISTPILIDQGEDDKFLA
KQLLPRNFEEACKAVGAPLTLRMQPGYDHSYFFIATFIDDHIAHHSQFLKSA
NT seq 879 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgccctctcccccacccgtcgcggcgctggagcagatgagcaggacc
aaaatgttcggcggccacaacctccgcttccgccaccacagcgccacgctcggctgcccc
atgaccttctccgtcttcctcccgccgtcgccggcatccgacctccccgtgctgtactgg
ctctccggcctcacgtgcaacgacgagaacttcgtcaccaaggccggcgcgcagcgcgcc
gccgccgcccacggcatcgccctcgtcgcccccgacacctccccacgtgggcttaatata
gagggagaggcagacagttgggattttggtgttggtgctggattctatttgaatgcaaca
aatgaaaagtggaaaaattggcgcatgtatgactatgttgtgaaggagcttccaaaagtt
ttaagtgacaactttgaacagctgaacacttcacgggcatctatttttgggcactcaatg
ggagggcacggtgcactaacaatctacttaaagaacactgataaatacaagtcggtgtct
gcattctctccggttgtcaatccaatcaactgcccttggggtcagaaagcattctcaaac
tatttgggcccagctaaatcagattggaaggaatatgatgcaacctgcctgatcaagaag
tgcaacaaaatttcaactcctattctgattgaccagggagaggatgacaaatttctggca
aagcagcttctacctcgcaactttgaggaggcgtgcaaggctgtgggagctcctttgact
ctccgcatgcaacctggatacgaccactcctacttttttattgctacattcattgatgat
cacattgctcaccactctcaatttctgaagagtgcctga

DBGET integrated database retrieval system