KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326521
Entry
4326521           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase subunit 4, mitochondrial
  KO
K25801  succinate dehydrogenase (ubiquinone) subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4326521
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4326521
SSDB
Other DBs
NCBI-GeneID: 4326521
NCBI-ProteinID: XP_015619484
UniProt: Q942X4
LinkDB
Position
1:complement(41085909..41088163)
AA seq 211 aa
MASRLLARSKALALALSRADAAAPGPAAGVQWLRTLSSLPRDPAAAASPAPAPRQPAVGS
PLGLSKIPGYEQTSRLSGTQVLPRWFSTGTSNGSSAQQEGATRKVMAFSPLEASIAKPRK
GPLTSESWKVKQTELLTRSTYYMIPTLLLVSKNSISTSLLVASVFHQVYMFYKEILLDYV
HHDITRKWVFIYFKILLIIMAKETVVYFDLF
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcgtcgcgcctcctcgcccgatccaaagccctagcgctcgccctgtcccgcgccgac
gcggcggcgccggggcccgccgccggagtgcagtggctccgcacgctgtcctccctcccc
cgcgatccggccgccgccgcctcccccgcccccgcgccgcgccaacccgccgtggggtcc
cctctcggcctctccaagattccaggatatgaacagacatctcgactcagtggtacacaa
gtattgcctcgttggttttctactggaacatcaaatggatcttctgctcagcaggaggga
gccaccagaaaggtaatggcattcagcccattagaagcaagcatcgccaaacccagaaaa
ggtccattgacatctgaaagctggaaagtgaagcagacagagctactaacacgatctacg
tattacatgatcccaactctgcttcttgtatcaaagaacagcatcagtacgtctcttctg
gtcgcatcagtattccatcaagtctacatgttctacaaggagatccttctggactatgtc
catcacgatatcaccaggaagtgggttttcatatacttcaagattctcctgataatcatg
gccaaggaaacagttgtctacttcgatttattttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338591
Entry
4338591           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase subunit 4, mitochondrial-like
  KO
K25801  succinate dehydrogenase (ubiquinone) subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4338591
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4338591
SSDB
Motif
Pfam: CybS Ribosomal_L22
Other DBs
NCBI-GeneID: 4338591
NCBI-ProteinID: XP_015637812
UniProt: Q6I5Q7 B9FP86
LinkDB
Position
5:complement(17914293..17917830)
AA seq 200 aa
MASRLVARSRRGLALALSRAGAGAPSRPSPPGLGKTLGYEPTSHLHGAQFLPCWFSTIAS
NGSHMQKAQETCKPVAGMEHSDALKVMEGTSPKVVAFSPLEAAITKPRSSPLTIESSKVK
RSEIATLVTFYMIPSLLVSSKNGLATSILVGAVFHQIYMFHKEIFLDYVHHDITRKWALI
YFKLLLLIMAKETIVYFNFI
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcgtcgcgactcgtggcccggtcgaggagaggcctagcgctcgccctctcccgcgcc
ggcgccggcgccccgtcgcggccctcccctcctggcctcggcaagactctggggtatgag
ccaacatcacatctccatggtgctcagtttttaccttgttggttttcaactattgcatct
aatggatctcacatgcaaaaggcacaggagacatgtaagccagttgctggaatggaacac
tctgatgcactgaaagtaatggaaggaacctctcctaaagttgtggcattcagcccacta
gaagcagctatcactaaacctagaagcagtcccttgacaattgaaagttctaaagtaaag
cgatcagagattgcaacgctagtcacattttacatgatcccttctctgcttgtttcctca
aaaaatgggcttgctacctctattttggttggcgcagtattccatcaaatatacatgttt
cacaaggagatatttctggactatgtgcaccatgatatcaccaggaagtgggctttgata
tacttcaagctgcttttgttgatcatggcgaaggaaaccattgtgtatttcaactttatc
tga

DBGET integrated database retrieval system