KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326564
Entry
4326564           CDS       T01015                                 
Name
(RefSeq) single-stranded DNA-binding protein, mitochondrial
  KO
K03111  single-strand DNA-binding protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4326564
   03430 Mismatch repair
    4326564
   03440 Homologous recombination
    4326564
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4326564
   03400 DNA repair and recombination proteins [BR:osa03400]
    4326564
   03029 Mitochondrial biogenesis [BR:osa03029]
    4326564
DNA replication proteins [BR:osa03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    4326564
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     4326564
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    4326564
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    4326564
SSDB
Motif
Pfam: SSB CCSAP
Other DBs
NCBI-GeneID: 4326564
NCBI-ProteinID: XP_015622362
UniProt: Q5VP75 A0A0P0V5X6
LinkDB
Position
1:complement(25835967..25843525)
AA seq 224 aa
MAATASSFLARRLLLTRRVLSSPLRPFSTTDSSSSSSSSSSSDDSRAGSDAGPDPEQQQP
PPAGQDQQAAARPRAGDTRPLENGLDPGIYKAIMVGKVGQEPIQKRLRSGRTVVLFSLGT
GGIRNNRRPLDREEPHQYAERCSVQWHRVCIYPERLGSLALKHVKTGSVLYLEGNLETKV
FSDPITGLVRRIREIAVRSNGRLLFLGNDCNAPKLGEAKGVGYF
NT seq 675 nt   +upstreamnt  +downstreamnt
atggcggccacggcctcctccttcctcgcccgccgcctcctcctcacccgccgcgtcctt
tcctcccccctccgccccttctccaccactgactcctcctcatcctcctcctcctcctct
tcctccgacgactcccgtgcgggatctgatgcgggacccgaccccgagcagcagcaaccg
ccaccagcgggccaggatcagcaggccgccgcccggccgcgcgccggcgacacccgtccc
ctcgagaacggccttgaccccggaatctacaaggcgataatggtggggaaggtggggcag
gagccgatacagaagcggctgaggagcgggagaacggtcgtgctgttctcgctcggcacc
ggcggcatccgcaacaaccgccgcccgctggaccgcgaggagccgcaccagtacgctgaa
cgatgctccgtgcagtggcaccgcgtctgcatctacccggaacggctcggcagcctcgcg
ctcaagcacgtcaagaccggttctgttctttatctggaagggaatcttgagacgaaagtg
ttttctgatcctataactggactggttcggcgcataagagaaatagctgtgcgctcaaat
ggccgtctcttgtttcttgggaatgattgtaatgcgcccaagttaggtgaagccaagggc
gttggctacttctga

DBGET integrated database retrieval system