KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326680
Entry
4326680           CDS       T01015                                 
Name
(RefSeq) neutral ceramidase
  KO
K12349  neutral ceramidase [EC:3.5.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4326680
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     4326680
SSDB
Motif
Pfam: Ceramidase_alk Ceramidse_alk_C
Other DBs
NCBI-GeneID: 4326680
NCBI-ProteinID: XP_015620868
UniProt: Q0JL46
LinkDB
Position
1:complement(24913552..24924009)
AA seq 785 aa
MEASSWLCYQARGFGSSRVWLWLLLALVLLNCSLVLSASPYLVGMGSFDITGPAADVNMM
GYANTEQIASGIHFRLKSRAFIVAEPNGKRVVFVNIDACMASQIVTIKVLERLKARYGDL
YNENNVAISGIHTHAGPGGYLQYVVYIVTSLGFVRQSFDVIVDGIEQSIVEAHNNLRPGK
IFVNKGDLLDAGVNRSPSAYLNNPAEERSKYEYNVDKEMTLIKFVDDELGPVGSFNWFAT
HGTSMSRTNSLISGDNKGAAARFMEDWAEQMGLPKQSAHANSDDLRSLHKTSVLPRRVST
IIPEPNEITDDLIQLASSYEASGGRRLAGSSITRRIRSTQQNKPKFVSAFCQSNCGDVSP
NVLGTFCIDTNLPCDFNHSTCNGKNELCYGRGPGYPDEFESTRVIGNRQFLKARDLFDSA
SEEIQGKIDYRHTYLDFSKLEVKVSTSAGGQQTVKTCPAAMGFAFAAGTTDGPGAFDFRQ
GDVKGNPFWKLVRNLLKTPGKDQVECHSPKPILLDTGEMKEPYDWAPAILPVQMIRIGQL
VILCVPGEFTTMAGRRLRDAVKTVLTSGNSEFDKNIHVVLAGLTNSYSQYITTFEEYQIQ
RYEGASTLYGPHTLSAYIQEFQKLAMAMIANKEVPTNFQPPDMLDKQIGLLPGVVFDSTP
LGVKFGDVNSDVPGNSTFNKGSTVNATFYSACPRNDLLTDGTFALVEKLDGNNNWVPVYD
DDDWSLRFKWSRPARLSSRSFATLEWTVPEDAAAGVYRLRHFGASKPMFGSVRHFTGTSR
AFAVR
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggaggcttcatcttggttgtgctaccaagctcgtggttttggttcatccagagtatgg
ttatggcttcttctagctcttgttcttctgaattgcagcctggtactctcagcctcgccg
tatctggtcggtatggggagcttcgacataacaggacctgcagcagatgttaacatgatg
ggatatgcaaatactgagcagattgcatcgggaattcacttcaggctgaagtcacgtgca
tttattgtggctgagcctaatggaaagcgtgttgtgtttgttaatatcgatgcttgtatg
gcatcacagattgtgactataaaggtgcttgaaaggctaaaagcaaggtatggtgatctt
tataatgagaacaacgtggctatcagtggcatccacactcatgctgggcctggaggttat
cttcagtatgtagtttatattgtcacgtctcttgggtttgttcgccaatcctttgatgta
attgttgatggcatcgagcaaagcattgttgaagctcataacaacctccgtcctgggaaa
atatttgtgaataaaggtgacctccttgatgctggtgtgaatcgcagcccaagtgcatac
ctaaataatcctgccgaagagagaagcaagtacgagtataatgttgataaagaaatgacc
ctcatcaagtttgtagacgatgaactgggtccagttggaagtttcaattggtttgcaact
catggaacatcaatgagccgtacaaattctttgataagtggtgataacaagggagccgct
gcacgcttcatggaagactgggctgaacaaatgggcttgcccaaacagtcagctcatgca
aattctgatgatttgagatctttgcacaagacatctgtacttcctcggagagtttctact
ataattcctgaaccaaatgagataactgatgacttgatacaattggcatcatcctatgag
gcctcaggtggcaggcggttggcaggttcaagtatcactaggcgcattagaagtactcaa
caaaacaaacctaaatttgtttctgcattttgtcagtccaattgtggagatgttagtcca
aatgtccttggaacattttgcatagacaccaatcttccctgtgacttcaatcacagcaca
tgtaatgggaaaaatgaactttgctatggacgaggcccaggataccctgatgagtttgaa
agtacccgtgttattgggaataggcaatttctaaaggctagagatctctttgattcagct
tctgaagaaatacaaggcaaaattgactataggcacacttatttagatttctcaaaactt
gaagttaaagtttctacaagtgcaggcggtcagcagaccgtgaaaacatgcccagcagca
atgggctttgcttttgctgctggaaccacagatggccctggagcttttgatttcagacaa
ggagatgtcaagggaaaccctttctggaagttagtaaggaacttgttaaagacaccaggg
aaggaccaagttgaatgtcattctccaaaaccaatattgctagacactggtgaaatgaag
gaaccatatgattgggcgcctgcgatacttccagttcaaatgattagaattggtcagctg
gttatcttgtgtgttcctggagaattcacaacaatggctggcaggcgtctacgtgatgct
gtgaaaactgttcttacaagtggaaacagtgaatttgataaaaatattcatgttgttctt
gcggggctaacaaacagctactctcagtacattacaacttttgaagaataccagatccaa
agatatgagggagcatcaacgttgtatggtccccacaccttgagtgcctatatccaagaa
tttcagaaacttgctatggccatgattgcaaacaaagaggtcccaacaaatttccaacct
cctgatatgttggacaagcaaattggactacttcctggtgttgtttttgactcaactcct
cttggtgtcaagtttggggatgtcaactcggatgttcctggtaactcaacattcaacaag
ggtagtactgtgaatgctacattttattcagcatgcccaaggaatgaccttcttacggat
ggtacctttgcactcgtcgagaagctagatggtaacaataattgggttcctgtctacgat
gatgatgattggtcattgcgtttcaagtggtcaaggcccgcaagattgagttcaagaagt
tttgcaactctagagtggacagttcctgaagacgctgctgctggtgtttacagattgagg
cattttggtgcctccaaaccaatgtttggttcggtcaggcattttacaggaacctctcgt
gctttcgcggtgcgttag

DBGET integrated database retrieval system