KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326682
Entry
4326682           CDS       T01015                                 
Name
(RefSeq) protein SGT1 homolog
  KO
K12795  suppressor of G2 allele of SKP1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4326682
SSDB
Motif
Pfam: SGS CS TPR_16 TPR_2 TPR_1 TPR_8 TPR_19 TPR_11 TPR_14 TPR_9 ANAPC3 TPR_17 TPR_12 Fis1_TPR_C Biotin_carb_N NatA_aux_su
Other DBs
NCBI-GeneID: 4326682
NCBI-ProteinID: XP_015621707
UniProt: Q0JL44
LinkDB
Position
1:24937656..24942887
AA seq 367 aa
MATAAASDLESKAKAAFVDDDFELAAELYTQAIEASPATAELYADRAQAHIKLGNYTEAV
ADANKAIELDPSMHKAYLRKGAACIRLEEYQTAKAALELGYSFASGDSRFTRLMKECDER
IAEELSEVPVKKAEDGAAAPSVASFVEEKDDAANMDNTPPMVEVKPKYRHDFYNSATEVV
LTIFAKGVPAENVVVDFGEQMLSVSIEVPGEEPYHFQPRLFSKIIPEKSRYQVLSTKVEI
RLAKAEQITWTSLDYDKKPKAVPQKIIPPAESAQRPSYPSSKSKKDWDKLEAEVKKEEKE
EKLEGDAALNKFFRDIYSDADEDMRRAMMKSFVESNGTVLSTNWKDVGSKKVEGSPPDGM
ELKKWEY
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggcaaccgccgccgcgtcggatctggagagcaaggccaaggcggccttcgtcgacgac
gacttcgagctcgccgccgagctctacacgcaggcaatcgaggccagccccgccaccgcc
gagctctacgccgaccgcgcccaggcccatatcaagctaggcaactacactgaggctgta
gctgatgctaacaaggccattgaacttgacccatcaatgcacaaggcttatcttcgtaaa
ggcgctgcatgtatacgactggaggagtatcaaactgcaaaagcagctcttgaattgggt
tactcgttcgcatctggtgactcaaggtttactcgcctaatgaaggagtgtgatgagcgc
attgctgaggagcttagtgaagtccctgttaagaaggctgaagatggagcagctgccccc
tctgttgcttcttttgttgaggaaaaggatgatgctgcaaacatggataatacaccacca
atggtagaagtgaagccaaaatacaggcacgacttctacaacagtgctacagaagttgta
ttgacaatttttgcaaagggtgttcctgctgagaatgttgttgttgattttggtgaacaa
atgttaagtgtgtcgattgaagtccctggagaggagccgtaccattttcagcctcgtctg
ttttctaagatcatccctgagaaaagcagataccaagtgctatccacgaaggttgaaata
agactggctaaagctgaacagattacatggacctcacttgattatgataaaaaaccaaag
gctgttccacaaaagataatccctccagctgaatcggcccagaggccatcatatccttcc
tcaaaatccaagaaagactgggataaactggaagctgaagttaaaaaggaggagaaggag
gagaagcttgaaggcgatgctgcattgaacaaatttttccgtgacatctacagtgatgct
gatgaagacatgcgacgagcaatgatgaaatcttttgttgaatctaacggtactgttctg
tcgaccaattggaaagatgttggctcgaagaaggtagagggaagcccacctgatgggatg
gagcttaagaaatgggagtactaa

DBGET integrated database retrieval system