KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326894
Entry
4326894           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4326894
  KO
K01455  formamidase [EC:3.5.1.49]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00460  Cyanoamino acid metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4326894
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4326894
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    4326894
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.49  formamidase
     4326894
SSDB
Motif
Pfam: FmdA_AmdA PPR_2 PPR PPR_3 PPR_1 E_motif PPR_long TPR_17
Other DBs
NCBI-GeneID: 4326894
NCBI-ProteinID: XP_015639378
LinkDB
Position
1:complement(32226154..32232588)
AA seq 944 aa
MTGGLPPPLRPSTAPPPPSVTRALHAINTCTTAAALAPIRGAILGDRALLRSTAVVSAFF
LACGRLRHLDPALSLFACHPRPHVFVFNSLLRSLGRAPARSPLPLFRHFLRCRGVRPNRF
TFPLLLTSLSSLADLRAVHCQVVKSGFGPDLHVRNALLARYADCDPDLAHAEQMFDEMPR
PEVVAWTTMITSYRNRGRTFHALATFRRMLAAHVAPNRVTMVAALGACAAHCAVDTGIWI
HEYVQKQGWEMDVVLGTALVDMYGKCGKVSDGMHVFSKMAKRNVYTWNSIIGALALAQDG
KTALQWFSRMQNDGVQPDEVTLICVLCACAHAGFVDIGRKIFNLAIQGEYGFQPGIKHFG
CMVDLLSRSGHLDDAFRVVETMPSQPNAVIWGLLLRGCRARGDSWLSEHVTMRLVELEPE
NASHYVLLSNLYAETGRWQEAQGILHWMKKKGLRKDAGWSLRMLEDKSKKYTTDGCLLEY
VESLPSLQQNMALPTPRLVVPIDVSKKPWEQKVPLHNRWHPDIPPVADVTEGELFRVEMV
DWTGGRVSDDNSADDIKFLDLTITHYLSGPLRIVDAEGVPAAPGDLLAVEICNLGPLPGD
EWGYTAIFERENGGGFLTDHFPSARKAIWYFEGIYAYSPQIPGVRFPGLTHPGIVGTAPS
AELLNIWNEREKILAETNHESIKICEVLHQRPLANLPTPENCLLGKIQEGTADWQKIANE
AARTIPGRENGGNCDIKNLSRGSKVYLPVFVDGANLSTGDMHFSQGDGEVSFCGAIEMSG
FLELKCEIIRGGMKEYLTPIGPTPLHVNPIFDIGPVEPRFSDWLVFEGISVDESGKQHFL
DASVAYKRAVLNAIEYLSRFGYSKEQVYLLLSCCPCEGRISGIVDSPNAVATLAIPTAIF
DQDVKPKRLSGKQGPKLRRLPDVLRCSSDGHLPVTQDPSGTKAP
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgaccggcggcctcccgccgcctctccgcccgtccaccgcgccgccgccgccctccgtc
acgcgcgcgctgcacgcgatcaacacctgcaccaccgccgccgcgctcgcgcccatccgc
ggcgccatcctcggggaccgcgcgctcctccgctccaccgccgtcgtctccgccttcttc
ctcgcctgcggccgtctccgccacctcgacccggcgctctccctcttcgcctgccacccg
cgcccccacgtgttcgtcttcaactcgctcctccgctccctcggccgcgcccccgcccgc
tccccgctcccgctcttccgccacttcctccgatgccgcggcgtccgccccaaccgcttc
accttccctctcctgctcacctccctgtcctccctcgccgacctgagggccgtgcattgc
caggtggtcaagtccgggttcgggcccgacctccacgtccgcaacgccctcctcgcgcgc
tacgcggactgcgaccctgacctggcgcacgccgagcagatgttcgacgaaatgccccga
ccggaggttgtcgcgtggaccactatgatcacctcatacaggaaccgaggccgcaccttt
cacgctctggcgaccttccggcggatgcttgctgctcatgttgcacccaaccgcgttacc
atggttgctgctcttggcgcttgcgcggcccattgtgcggtcgacactggcatctggatt
cacgagtacgtgcagaagcagggatgggagatggatgttgtactgggcacagcgctggta
gacatgtatgggaagtgtggaaaagtctcagatggaatgcatgtgttctcaaagatggcc
aagaggaatgtctatacttggaactctatcattggagcacttgctcttgcacaggatggc
aagacggcattgcagtggttctctcggatgcagaatgatggtgtccagccagatgaagtc
acacttatttgtgttctttgtgcctgtgcacatgccgggtttgttgacattgggaggaaa
atatttaacctggccatacaaggtgagtatgggtttcaacctgggatcaagcactttggg
tgcatggttgaccttcttagtcgctctggacacctcgatgatgcctttagggttgttgag
acaatgccatcacagccaaatgcagtgatatggggcttgctattaagaggctgcagggcc
cgtggcgactcatggttgagtgagcatgtgacaatgaggctggtggagttggaacctgag
aatgcatcgcattatgttctgttatcaaatttgtatgctgagacagggaggtggcaggaa
gctcaggggatcttgcattggatgaagaagaagggactgaggaaagatgcaggctggagc
cttcgaatgttagaggacaagtcaaagaagtatactactgatggatgtttgttggagtat
gttgagtcccttccctccctgcaacagaacatggctcttccaacaccaagattggtagtt
cctatagatgtgagcaagaagccatgggagcaaaaagtccctctccataaccgctggcat
ccagatatccctcctgttgcagatgtaactgaaggggaattgttccgtgttgagatggtc
gattggactggaggaagagtcagtgatgataactccgcagatgacatcaaattcctggat
ctcacaattactcattatcttagtgggcccttaagaatagttgatgctgaaggggttcca
gctgcacctggtgatcttcttgctgtagagatctgcaaccttggtccacttcccggtgac
gaatggggatatactgccatatttgaaagggagaatggtggtggattcttaaccgaccac
ttccctagtgcaagaaaggcgatttggtattttgaaggaatttatgcatactcccctcaa
ataccaggtgtccgatttccaggattaactcatcctggtatagtggggactgcaccatct
gctgagcttctcaatatatggaatgagagggaaaaaatattggctgagacaaatcatgag
tcaatcaaaatctgtgaagttctacatcagaggcctcttgccaacttaccaacccctgag
aactgtttacttggaaagattcaagaagggactgctgattggcagaaaatcgcaaatgaa
gcagcaagaactattcctggaagggagaatggagggaattgtgacatcaagaatctaagt
agaggttccaaggtttatctcccggtatttgttgatggagcaaatctgagtactggtgac
atgcatttttcccagggtgacggcgaagtctcattctgtggagcaatagaaatgagtgga
tttcttgagctcaagtgtgagatcataagaggtgggatgaaggaatacttgactccaata
ggtccaacaccacttcatgtgaatcctatctttgatataggtccagtggaaccacgtttc
tcagactggttagtctttgagggcatcagtgtagacgagtctgggaagcagcattttctt
gatgcatcagttgcctacaagcgtgctgtcctcaatgccattgagtacctttccagattt
gggtactccaaggagcaggtataccttttgctatcatgctgcccatgtgagggtaggata
tctggaatagtagactcccctaatgcagtggcaactcttgccatccctacagcaatattt
gaccaggatgtaaaaccaaaacgcctgagtgggaaacaaggaccaaagttgagaaggctt
ccagatgttttgagatgctcgtccgatggacaccttcctgttacacaggacccaagcggt
acaaaggcaccttaa

DBGET integrated database retrieval system