KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326895
Entry
4326895           CDS       T01015                                 
Name
(RefSeq) deoxycytidylate deaminase
  KO
K01493  dCMP deaminase [EC:3.5.4.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4326895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4326895
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.12  dCMP deaminase
     4326895
Secretion system [BR:osa02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   4326895
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam Bd3614-deam SNAD4
Other DBs
NCBI-GeneID: 4326895
NCBI-ProteinID: XP_015626126
UniProt: A0A0P0V8M7 Q5JN09
LinkDB
Position
1:complement(32233083..32239038)
AA seq 248 aa
MASARDLAVASISAAVGAAAAAAALRFLSSYGASSAKQRSPPTPCAEHLAVNGCAAERPP
VQSPFDPAKREGYISWDDYFMAIAFLSAKRSKDPNRQVGACLVSQEGIILGIGYNGFPRG
CSDNKLPWAKKSAKGDPLETKYPYVVHAEVNAILNTNHASAAGQKLYVTMFPCNECAKII
IQSGVSEVIYFVEKRIDNSDYVYVASHKLLSMAGVKVRKHQPQMSQIPIKFQEPRNGEPS
MNAASIFS
NT seq 747 nt   +upstreamnt  +downstreamnt
atggcctcggcgagggacctcgccgtagcgtccatctccgccgccgtgggcgccgcagcc
gccgcggccgcgctgcgcttcctgtcatcctacggggccagctctgccaagcagcggagc
ccgcccacgccgtgcgccgagcacctcgcggtcaacggatgcgccgccgagcgcccgccg
gtgcagtcccccttcgatcccgccaagagggaagggtatatctcctgggacgactacttc
atggcgatcgcgttcctttcggccaagcggtccaaggatcctaatcggcaggttggagca
tgcttggttagccaagaggggataatcctaggaatagggtataatggatttcctagaggt
tgttctgacaataagctaccctgggcaaagaaatctgccaagggagatccattggagaca
aaatacccctatgttgttcatgctgaggttaatgctattttaaatacaaaccatgcttca
gcggctggacagaaattatatgttaccatgttcccctgcaatgagtgtgctaagattatt
atccagtcaggtgtatctgaagtcatatattttgtagagaaaaggattgacaactctgat
tatgtttacgtagcctcgcacaagttgttatcaatggctggtgtaaaggttaggaaacac
caaccacagatgtcacaaataccaatcaagtttcaggagcctcgaaacggtgagccttca
atgaacgcagcaagtatatttagctga

DBGET integrated database retrieval system