KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327080
Entry
4327080           CDS       T01015                                 
Name
(RefSeq) protein IWS1 homolog A
  KO
K03504  DNA polymerase delta subunit 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4327080
   03410 Base excision repair
    4327080
   03420 Nucleotide excision repair
    4327080
   03430 Mismatch repair
    4327080
   03440 Homologous recombination
    4327080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4327080
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4327080
   03400 DNA repair and recombination proteins [BR:osa03400]
    4327080
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4327080
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4327080
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4327080
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     4327080
SSDB
Motif
Pfam: CDC27 MsyB
Other DBs
NCBI-GeneID: 4327080
NCBI-ProteinID: XP_015624950
UniProt: Q5QNL2 A0A8J8XUI1
LinkDB
Position
1:complement(5718900..5724193)
AA seq 512 aa
MAAAAADPALLDLIPQIHALFADPLRVISYKWLSRNFSVSSNDSKRLLQEFVNKHGADLK
VIYSVSGWLKKNPTNYCVKLTSGHKLEEARQEFKDSCSVQVYSIQACIPKDTAVLWNPEF
VQAEELFNRPFDEENCLRDNRFCGVLNSFVKRTANGKLVSSFPPKPINSVAAAAPLKTSS
APKEQSAKGQQQGLPGSSSPKKGTSNKAEKDISSVLDKATNAPVVKEPSIALQGNKNKAQ
NGKALPSNGGSLATMWGRASAKPKTPATTNPTVLPSVAVTADAQICAKEEANADSSDDEQ
AVHYKRGSSANNRKRRAVFDLSDDDEDDNVVAIASPEPPEQCITNPIDEVAQESNPKQEN
LENKQEVEKDVKCCIGRTESPECKTKSSNTVSHSGITLKEKNNGPPPNDNKQDHAAETAS
NSPKRRKVLKTRIDERGREVTEVVWEGEASAGDKAEKNVSDTGAANRATLSSKPQPVAKT
EKSNASSKTAGNKKPAKAGTKQGNIMSFFKKV
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcggccgccgccgcggacccggccctgctcgacctgattccccagatccacgccctc
ttcgccgatccgctccgtgtgatttcatacaaatggctcagcaggaacttctcagtatca
tccaatgattcaaagaggttgcttcaggagttcgtcaacaaacatggggctgatcttaaa
gtgatttacagtgtgtctggatggttaaagaagaaccccacaaattattgtgtaaaactc
acttcaggccataaacttgaagaagcaaggcaagaatttaaagattcttgttcagttcaa
gtgtacagtatccaggcttgtattccaaaagatactgctgtactttggaatcctgaattt
gtacaggcagaggagctttttaaccggccatttgatgaagaaaattgtttgagagataat
aggttttgtggtgttttgaattcttttgtcaagcgaactgctaatgggaagcttgtgagt
tcatttccgccaaagcctataaatagtgttgctgcagctgcaccgttgaaaactagtagt
gctccaaaagaacaatctgctaagggtcaacagcaaggtctacctggatcatccagtcca
aagaaaggaacaagtaataaggctgagaaggatatttcctcggtcttggataaagccacc
aatgctcctgttgtcaaagaaccatcaattgctctgcagggaaacaaaaacaaggctcag
aatgggaaggcgctgcccagtaatggtggatcacttgctacgatgtggggacgtgcatca
gctaaacccaagactccagctaccactaatcctacagttttaccaagtgttgctgttaca
gctgatgcacaaatatgtgcaaaggaagaagcaaatgctgatagtagtgatgatgaacaa
gctgtacactacaagcgtggctctagtgcaaataacagaaagagaagagcagtctttgat
ctttcagatgatgatgaagatgacaatgttgtagccattgcatctcctgagccaccggaa
cagtgcattacaaatcctattgatgaggttgctcaagaaagtaaccccaaacaagaaaac
ttggaaaataaacaagaggttgagaaggatgtgaaatgttgcataggaaggacagagtct
cctgagtgtaaaaccaaaagtagcaacactgtcagccattctgggatcaccttaaaagaa
aagaacaatggtccaccacctaatgacaataagcaggatcatgctgctgagactgcttcc
aactcacctaaaagaaggaaagttttgaagacacgaatagatgagcggggaagagaagta
accgaggttgtctgggagggtgaagcttctgcaggtgataaggctgagaagaatgtgagc
gatactggtgctgcaaacagggcaactctctcaagcaagccgcagccagtagcaaagacc
gaaaaaagcaatgcttcgagtaaaacagccggcaacaagaaacctgccaaggctggaacc
aagcaaggcaacattatgtcattcttcaagaaggtataa

DBGET integrated database retrieval system