KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327104
Entry
4327104           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L3-2, chloroplastic
  KO
K02906  large subunit ribosomal protein L3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327104
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327104
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4327104
  Bacteria
    4327104
  Archaea
    4327104
SSDB
Motif
Pfam: Ribosomal_L3
Other DBs
NCBI-GeneID: 4327104
NCBI-ProteinID: XP_015617381
UniProt: Q9LIT4 A0A8J8YFM9
LinkDB
Position
1:8291323..8296216
AA seq 319 aa
MAAVSRGLLARLRHLSIAGPRLPPCCRPFSAEPLVSHPDDDDAAAGGGGGGGEGSGGGRI
IEARAGVMGPDSRRTGVIGVKCGMSAMWDKWGAKVPITVLWVDDNVVCQVKTAEKEGFFA
LQLGAGQKKEKHLTKPEVGHFRAQGVPLKRKLREFPVTEDALIPLGTTITVRHFVPGQFV
DVTGITKGKGFAGGMKRHGFSGMPASHGASLSHRSIGSTGQRDAPGRVFKNRKMPGRMGG
VQRTVKNVWVYQIDPARNLLYLKGQVPGPQGSFVFVKDSIYKKPDIAKLPFPTYFSQEGE
SEELLVADLGDIDPFMVAD
NT seq 960 nt   +upstreamnt  +downstreamnt
atggcggccgtctcgaggggcctcctcgcgcgcctccgccacctctccatcgcgggccca
cgcctgcccccttgctgccgccccttctccgccgagcccctcgtctcccaccccgacgac
gacgacgccgccgccgggggcggcggcggcggcggcgagggatcgggagggggacggatc
atagaggctcgggcgggggtgatgggcccggactcgcggcggaccggcgtgatcggcgtc
aagtgcggcatgtcggcgatgtgggacaagtggggcgccaaggtgcccatcaccgtcctc
tgggtcgacgacaacgtcgtctgccaggtcaagaccgccgagaaggaggggttcttcgcg
cttcagcttggagcaggccaaaagaaggaaaaacatctaacaaaacctgaagtgggccac
ttcagagcacaaggagtccctctaaagagaaaactaagggagtttcctgttactgaagat
gcacttattcctcttggaacaacaatcacagttcgccattttgtgcccggacaatttgtg
gatgttactggaatcacaaagggcaaaggttttgcgggtggtatgaaaagacatggtttt
agtgggatgcctgcatcacatggtgcatctctatcacatcggagcatcggttctactggt
caaagagatgctcctggaagggtcttcaaaaacagaaagatgcctggacgtatgggtggt
gtacagcgcaccgtgaaaaatgtatgggtttatcaaatagaccctgccaggaacttattg
tatctgaaaggccaggttcctggtcctcaaggcagctttgtttttgttaaggactcaata
tacaagaaacccgacatagctaagctgcctttcccaacatatttctcacaagaaggtgag
tcggaggagctcctcgtcgctgatcttggtgacatcgacccattcatggtagcggattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328236
Entry
4328236           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L3, chloroplastic
  KO
K02906  large subunit ribosomal protein L3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4328236
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4328236
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4328236
  Bacteria
    4328236
  Archaea
    4328236
SSDB
Motif
Pfam: Ribosomal_L3
Other DBs
NCBI-GeneID: 4328236
NCBI-ProteinID: XP_015625363
LinkDB
Position
2:complement(1972961..1974783)
AA seq 273 aa
MAMAAVGIGGGGGGALGLLAPRRRAASWSGAGGAAAAAARRRPLVAVVRASYEAGVGVMA
TKVGMMTYFDPATGKPVPVTVVGFREGGNVVTQVKTAATDGYDAVQVGYHGVREEKLTRP
ELGHLGKAGAPPLRHLQEFRLQSVDGYDPGQPLDFADMFKEGDLVDISGKSIGKGFQGGI
KRHNFKRGLMTHGSKSHRALGSIGAGTTPGRVYKGKKMPGRMGGTKTKIRKLKIVKIDND
LKVVMIKGAVPGKPGNLLRIAPAKIVGKNIPKN
NT seq 822 nt   +upstreamnt  +downstreamnt
atggccatggcggccgtgggcatcggcggcggcggcggcggcgcgctgggcctcctcgcg
ccgcgccgccgcgccgcctcctggagcggcgcaggtggcgcggctgcggcggcggcgcgg
cggcggccgctggtggcggtggtgcgcgcgtcgtacgaggccggggtcggggtgatggcg
accaaggtcgggatgatgacctacttcgacccggccaccggcaagccggtgccggtgacc
gtcgtggggttccgggagggcggcaacgtggtgacgcaggtgaagacggcggccaccgac
gggtacgacgccgtgcaggtggggtaccacggcgtccgcgaggagaagctcacccgcccg
gagctcggccacctcggcaaggccggcgcgccgccgctccgccacctgcaggagttccgc
ctccagtccgtcgacgggtacgaccccggccagccgctcgacttcgccgacatgttcaag
gagggcgacctcgtcgacatctccggcaagtccatcggcaaggggttccaaggtggcatc
aagaggcacaacttcaagcgagggctgatgacccacggctccaagagccacagagctctg
ggatcgatcggtgccgggacgacgccgggtcgggtgtacaaggggaagaagatgcccggg
aggatgggaggaaccaagaccaagatcaggaagctcaagatcgtcaagatcgacaacgac
ctgaaagttgtcatgatcaagggcgccgttccagggaagcccgggaacctcctccgcatc
gctcctgccaagatcgtcggcaagaacatccccaagaactag

DBGET integrated database retrieval system