KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327237
Entry
4327237           CDS       T01015                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 27
  KO
K04649  ubiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4327237
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4327237
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4327237
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4327237
SSDB
Motif
Pfam: UQ_con UBA DUF1421 RWD
Other DBs
NCBI-GeneID: 4327237
NCBI-ProteinID: XP_015618841
UniProt: Q8S1Y5 A3A140
LinkDB
Position
1:complement(40596063..40599106)
AA seq 195 aa
MVDVSRVQKELTECNRDREVSGVSIALHDGSTISHLTGTIAGPQGTPYEGGTFVIDIRLP
GGYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTLKTALLSLQALLSAPAPD
DPQDAVVAQQYLRDYSTFSATARYWTEAFAKNSSTGMEEKVQKLVEMGFPEDMVRSVLKS
VNGDENMALEKLCSG
NT seq 588 nt   +upstreamnt  +downstreamnt
atggtggacgtgtcgagggtgcagaaggagctgacggagtgcaaccgggacagggaggtc
tccggggtgtccatcgcgctccacgacggctccaccatctcccacctcaccggcaccatc
gccgggccccaaggcacgccctacgagggcggcaccttcgtcatcgacatccgcctccca
ggtggttacccctttgagcctcctaagatgcagtttatcaccaaagtatggcaccctaac
attagcagccaaaacggagcaatctgcttggacatactgaaggaccaatggagcccagcc
cttacattgaagacggcactgctttccctccaagctctgctttctgcccctgcacctgat
gatcctcaggatgctgtcgttgcacaacagtacttgcgtgactattccacattttctgct
actgctcgctactggacggaggcctttgcaaagaattcctccaccggcatggaagaaaag
gtgcagaagctggttgagatgggcttccctgaagacatggtgagaagtgttctgaagagt
gtcaatggcgacgagaacatggctcttgagaagctctgctctggctga

DBGET integrated database retrieval system