KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327382
Entry
4327382           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L17
  KO
K02879  large subunit ribosomal protein L17
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327382
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327382
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4327382
  Bacteria
    4327382
SSDB
Motif
Pfam: Ribosomal_L17
Other DBs
NCBI-GeneID: 4327382
NCBI-ProteinID: XP_015627914
UniProt: Q5N9V4 A0A8J8XHB8
LinkDB
Position
1:36007355..36009951
AA seq 161 aa
MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRRKADQMVQLGKEGTLDAA
RRASAFVRGDDVVHKLFTELAYRYKNRAGGYTRLLRTRIRVGDAAPMAYIEFVDRENELR
EAKPATPQPPQRSPLDPWAKSRASQQWAGPKISEGSRKEGL
NT seq 486 nt   +upstreamnt  +downstreamnt
atggggaagttccgcaagctcggccgccacgccgcccaccgagtatccatgctcaggacg
atggtgtcgcagctcgtgaagcacgagcgaatcgagaccaccgtcgccaaggcgaaggag
gtgcggcgcaaggcggatcagatggtgcagctcgggaaagagggcacattggatgcagca
agacgtgcttctgcttttgttcggggagatgatgttgttcataagctatttacagagcta
gcctaccgttacaagaaccgagctggtgggtacaccagactattgcgaactaggatacga
gttggtgatgctgcaccgatggcatacattgagttcgttgatagggaaaatgaacttcga
gaagccaaacctgcaacaccacagccacctcaacggtctcctcttgatccctgggccaag
tctcgtgctagccaacagtgggcgggacctaaaatcagcgagggctctagaaaagaaggc
ttatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334555
Entry
4334555           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L17
  KO
K02879  large subunit ribosomal protein L17
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334555
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4334555
  Bacteria
    4334555
SSDB
Motif
Pfam: Ribosomal_L17
Other DBs
NCBI-GeneID: 4334555
NCBI-ProteinID: XP_015630559
UniProt: B9F6Y0 Q75GR6
LinkDB
Position
3:34174764..34176691
AA seq 210 aa
MAAFATATPSPAISVSPWSMSSLRAALPSPTRASPAGKLRSSFSPAAAATAASVGCLSSF
SGLTPISPLLSLGEETSSFEHRLFGIDARGRIVAMRHGRRVPKLSRPPDQRKALLRGLTT
QLLKYGRIKTTRPRAKAMRKYVEKMITLAKDGSLHKRRQALAFIYEKHIVHALFAEVADR
YGEREGGYTRIIPTFPRRGDNAPMAYIELV
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcagccttcgccaccgcgaccccctcgccggcgatctccgtgtccccctggagcatg
tcgtcgctccgcgccgcgctcccctcccccacccgcgcctccccggcggggaagctccgg
tcgtcgttctcgcccgcggcggcggccacggcggcgtcggtcggctgcctcagctccttc
tccggcctcacccccatttcgcctctcctctccctcggggaagagacttcaagctttgag
catcgattgtttggtattgatgcccgtggaaggatagtggcaatgagacatgggaggcgt
gttcctaaacttagcagacctccagatcagcgaaaggcacttctgcgcgggctgaccacg
cagctgctcaagtacggaaggataaagactaccaggccaagagcaaaggcaatgaggaag
tatgttgagaagatgatcacactggcaaaggatgggtctcttcacaagaggaggcaggct
ctggcttttatctatgagaagcatatagtccatgcgttgttcgctgaggttgcagacagg
tatggggaaagagaggggggctacacaaggatcatcccaacatttccaagacggggagac
aatgcacctatggcttacattgagcttgtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339018
Entry
4339018           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L17 isoform X1
  KO
K02879  large subunit ribosomal protein L17
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339018
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339018
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4339018
  Bacteria
    4339018
SSDB
Motif
Pfam: Ribosomal_L17
Other DBs
NCBI-GeneID: 4339018
NCBI-ProteinID: XP_015638323
UniProt: Q0DHK1 A0A8J8XS46
LinkDB
Position
5:complement(22630263..22632524)
AA seq 196 aa
MGKFRKLGRHAAHRVSMLRTMVSQLVKHERIETTVAKAKEVRTKADQMVQLGKEGTLDAA
RRASAFVRGDNVVHKLFTELAYRYKDRAGGYTRLLRTRIRVGDAAPMAYIEHSKKKSSVS
FTKSRIAEGLSTGRMNFERQNLQHHSHLSGSLLIHGPSHSPANNGQVLKSARTPEQKAYD
KPERSLALFYVVERFF
NT seq 591 nt   +upstreamnt  +downstreamnt
atggggaagttccgcaagctgggccgccacgccgcccaccgcgtctccatgctcaggact
atggtgtcgcagctggtgaagcatgagcggatcgagaccaccgtcgcgaaggcgaaggag
gtgcggacgaaagcggatcagatggtgcagctcggcaaagagggtacgcttgatgcagca
agacgtgcctcagcctttgttcggggtgacaatgttgttcacaagttattcacagaactc
gcctaccgctacaaagatcgagctggtggatatacaagactactgcggactaggatacgg
gttggcgatgctgcaccaatggcatacattgagcattcaaaaaaaaaatcatccgtttct
ttcactaaatcaagaattgcagaaggtttgtcgaccgggagaatgaacttcgagaggcaa
aacctgcaacaccacagccacctcagcgggtccctcttgatccatggaccaagtcactcg
ccagcaaacaatgggcaggtcctaaaatcagccagaactccggagcagaaggcttatgac
aaaccagagcgttctctagctttattttatgttgttgagaggttcttttga

DBGET integrated database retrieval system