KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327391
Entry
4327391           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L36-3
  KO
K02920  large subunit ribosomal protein L36e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327391
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327391
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4327391
SSDB
Motif
Pfam: Ribosomal_L36e
Other DBs
NCBI-GeneID: 4327391
NCBI-ProteinID: XP_015625189
UniProt: B9EUC5
LinkDB
Position
1:complement(36083052..36085772)
AA seq 110 aa
MAPPQPKSGLFVGINKGHVVTKRELPPRPSDRKGKSTKRVNFVRGLIREVVGFAPYEKRI
TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVIRKMRSAGTTDKKK
NT seq 333 nt   +upstreamnt  +downstreamnt
atggcgccgccgcagcccaagtcggggctcttcgtcggcatcaacaagggccacgtcgtc
accaagcgcgagctgccacctcgcccgtccgaccgcaaggggaaaagtaccaagagagtg
aattttgtcaggggcttgattagggaggttgtgggatttgctccatatgagaaacgaatc
actgagcttctgaaggttggaaaggacaagcgtgcactgaaggtcgctaagagaaagctc
ggtacccacaagagagcaaagaagaagagagaggagatggcgggtgtcatcaggaagatg
aggtctgctggtactactgacaagaagaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339011
Entry
4339011           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L36-3
  KO
K02920  large subunit ribosomal protein L36e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339011
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339011
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4339011
SSDB
Motif
Pfam: Ribosomal_L36e
Other DBs
NCBI-GeneID: 4339011
NCBI-ProteinID: XP_015640666
UniProt: Q6L510 Q0DHK6
LinkDB
Position
5:22596350..22598351
AA seq 113 aa
MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKSTKRVTFVRNLIREVAGFAPYEKRI
TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVLRKMRSGGGHAHTEKKK
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcgccgtcgcagccgaagtccgggctcttcgtgggcatcaacaagggccacgtcgtc
accaagcgcgagctgccgcctcgcccgtccgaccgcaaggggaaatccaccaagagggtg
acctttgtcaggaacttgatcagggaggttgctggatttgctccctatgagaagcgtatc
actgagcttctcaaagttggcaaggacaagcgtgcactgaaggtggcaaagagaaagctt
ggcacccacaagagggccaagaagaagagagaggagatggctggtgtcctcaggaagatg
aggtctggtggcggtcacgctcacaccgagaagaagaaatag

DBGET integrated database retrieval system