KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327414
Entry
4327414           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S23
  KO
K02973  small subunit ribosomal protein S23e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327414
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327414
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4327414
SSDB
Motif
Pfam: Ribosom_S12_S23
Other DBs
NCBI-GeneID: 4327414
NCBI-ProteinID: XP_015611545
UniProt: Q8L4F2 Q7F4Z0
LinkDB
Position
1:complement(35759973..35761654)
AA seq 142 aa
MGKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ
PNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGRKGHAVGDIPGVRFK
VVKVSGVSLLALFKEKKEKPRS
NT seq 429 nt   +upstreamnt  +downstreamnt
atggggaagacacgtggtatgggagctgggcgcaagctcaagacccaccgcaggaaccag
agatgggcagacaaggcctacaagaagagccacttgggtaatgagtggaagaaacccttt
gctgggtcatctcatgccaagggcatcgttctggagaagattggtattgaggccaagcag
cccaactctgccatccgtaagtgtgctcgtgtgcagcttgtgaagaatgggaagaagatt
gctgcctttgtgcccaatgacggttgcctgaacttcattgaggaaaatgacgaggtgttg
attgctggatttggtcgtaagggccatgctgtgggagatattcctggtgtccggttcaag
gtcgtcaaggtctctggtgtgtctctgcttgctctcttcaaggagaagaaggagaagccg
aggtcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334580
Entry
4334580           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S23
  KO
K02973  small subunit ribosomal protein S23e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334580
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4334580
SSDB
Motif
Pfam: Ribosom_S12_S23
Other DBs
NCBI-GeneID: 4334580
NCBI-ProteinID: XP_015629855
UniProt: Q8L4F2 Q7F4Z0
LinkDB
Position
3:complement(34347217..34349410)
AA seq 142 aa
MGKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ
PNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGRKGHAVGDIPGVRFK
VVKVSGVSLLALFKEKKEKPRS
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtaagacacgtggtatgggagctgggcgcaagctcaagacccacaggagaaaccag
aggtgggccgacaaagcatacaagaagagccatcttggcaatgaatggaagaaacccttt
gctggttcatctcatgcaaagggcattgtccttgaaaagattggcattgaagctaagcag
ccaaactctgctatccgtaagtgtgctcgtgttcagttggtgaagaatgggaagaagata
gctgcctttgtgccgaacgatggttgcttgaacttcatcgaggaaaatgacgaggtgctc
atcgctgggtttggtcgtaagggacatgctgtgggagacattcccggtgtccgtttcaag
gtggtgaaggtctccggcgtctctctcctcgccctcttcaaggagaagaaggagaagcca
agatcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348383
Entry
4348383           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S23
  KO
K02973  small subunit ribosomal protein S23e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4348383
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4348383
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4348383
SSDB
Motif
Pfam: Ribosom_S12_S23
Other DBs
NCBI-GeneID: 4348383
NCBI-ProteinID: XP_015613322
LinkDB
Position
10:complement(10591143..10630308)
AA seq 135 aa
MGAGRKLKTHRRNQRWADKAYKKSHFGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIC
KCARVQLVKNGKKIAAFVPNDGCLNFIKENDEVLIVGFGWKGHALGDIPGVRLKVVKVSA
VSLLALFKEKKKQRS
NT seq 408 nt   +upstreamnt  +downstreamnt
atgggagctgggcgcaagctcaagacccaccgcaggaaccaaagatgggccgacaaggca
tacaagaagagccactttggcaatgagtggaagaaaccctttgctggatcatctcatgcc
aagggcattgttttggagaagattggtattgaggccaagcagccaaactctgccatctgt
aagtgtgctcgtgttcagctggtgaagaatgggaagaagattgctgcctttgtgccgaat
gacggttgcttgaacttcatcaaggaaaatgatgaggtgctgattgttggattcggttgg
aaagggcatgccttgggagatattccaggtgtcaggttgaaggttgtgaaggtgtctgca
gtgtcactgctcgcactcttcaaggagaagaagaagcagaggtcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266509
Entry
9266509           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S23
  KO
K02973  small subunit ribosomal protein S23e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9266509
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9266509
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    9266509
SSDB
Motif
Pfam: Ribosom_S12_S23
Other DBs
NCBI-GeneID: 9266509
NCBI-ProteinID: XP_015611534
UniProt: Q8L4F2 Q7F4Z0
LinkDB
Position
1:complement(35763641..35765217)
AA seq 142 aa
MGKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ
PNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGRKGHAVGDIPGVRFK
VVKVSGVSLLALFKEKKEKPRS
NT seq 429 nt   +upstreamnt  +downstreamnt
atggggaagacacgtggtatgggagctgggcgcaagctcaagacccaccgcaggaaccag
agatgggcagacaaggcctacaagaagagccacttgggtaatgagtggaagaaacccttt
gctgggtcatctcatgccaagggcatcgttctggagaagattggtattgaggccaagcag
cccaactctgccatccgtaagtgtgctcgtgtgcagcttgtgaagaatgggaagaagatt
gctgcctttgtgcccaatgacggttgcctgaacttcattgaggaaaatgatgaggtgttg
attgctggatttggtcgtaagggccatgctgtgggagatattcctggtgtccgattcaag
gtcgtcaaggtctctggtgtgtctctccttgctctcttcaaggagaagaaggagaagccc
aggtcttag

DBGET integrated database retrieval system