KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327558
Entry
4327558           CDS       T01015                                 
Name
(RefSeq) dihydropyrimidinase isoform X1
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa00410  beta-Alanine metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
Module
osa_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4327558
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4327558
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4327558
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327558
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.2  dihydropyrimidinase
     4327558
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4327558
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3 Amidohydro_2
Other DBs
NCBI-GeneID: 4327558
NCBI-ProteinID: XP_015651140
UniProt: A0A0P0V9G6 Q94J90
LinkDB
Position
1:34295656..34305938
AA seq 539 aa
MAMPCRLHGDILLLLLGAVAVAVAHPAANEFCAAVGGGSGGCGVGGGGGGDGRRILIRGG
TVVNAHRVEEADVYVEDGVIVAVRPNIPVGDDHVKVIDATGKYVMPGGIDPHTHLEMEFM
GTVTIDDFFSGHAAALAGGTTMHIDFVIPVNGNLTAGLESYKQKAEKSAMDYGFHMAITK
WNDDVSREMETMVKEHGINSFKFFMAYKGSLMVTDDLLLQGLQKCKSLGALAMVHAENGD
AVAEGQQRMIDLGITGPEGHALSRPPVLEGEATARAIRLAKFVNTPLYVVHVMSIDAMDE
IAKAKREGQRVIGEPVVSGLVLDDSWLWDPDFMIASKYVMSPPIREAGHNKALQVALSSG
ILQLVGTDHCTFNSTQKAFGSDDFRKIPNGVNGIEERMHIIWDSMVETGRISVSDYVRVT
STECAKIFNIYPRKGAILEGSDADIIILNPERSFVMGAHTHHSRSNTNVYEGRKGKGMVE
VTISRGRVVWEDGILNVVPGSGRYVRTPPYSYLFDGIEKSDAAYRASLRAPVKRGKAAA
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggcgatgccctgccgcctccacggcgacatcctgctgctcctgctcggcgccgtcgcc
gtcgcggtggctcacccggcggcgaacgagttctgcgcggccgtcggtggaggaagcggt
ggctgcggcgtcggcggcggcggcggaggggacgggaggaggatcctgatcaggggcggg
acggtggtgaacgcgcaccgggtggaggaggccgacgtgtacgtggaggacggcgtgatc
gtcgccgtgcggcccaacatcccggttggtgatgatcatgtaaaagtgattgatgcaact
ggaaaatatgtcatgccaggtggaattgaccctcacactcacctggagatggaattcatg
ggaactgtaaccattgatgatttctttagtggtcatgctgcagcattggctggtgggaca
acaatgcacattgacttcgtcattccagtgaatggcaatttaactgcaggtttggaatcc
tacaaacagaaggcagaaaaatctgccatggattatggatttcatatggccattacaaag
tggaatgatgatgtttcgagggaaatggaaacgatggttaaggaacatgggatcaattct
ttcaagttcttcatggcgtataaaggttcattgatggtcacggatgacctactcctgcaa
ggcttacagaaatgcaaatctcttggtgccttggctatggttcatgcagagaatggggat
gctgttgctgagggacagcaacgaatgatcgatcttgggataactggcccagaaggacat
gctctctcaagacctccagttttggaaggggaagcaactgctcgggcaattcgattagcc
aagtttgtcaatacaccattgtatgttgttcatgtgatgagcattgatgcaatggatgag
attgccaaggctaaaagagaagggcagagagtcattggtgaacctgtggtttctgggcta
gtacttgatgattcttggctttgggatccggacttcatgatagcttcaaagtatgtaatg
agtcctcctatccgagaagcaggacataataaagcacttcaagttgctctttcatcagga
attttacagcttgtaggaactgatcattgcaccttcaactccacacagaaagctttcggc
tctgatgatttcagaaagattcctaatggtgttaatggtatcgaggaaaggatgcatatt
atttgggacagtatggtggagactggccgaatttctgtcagtgattatgtgagagtgaca
agcacagaatgtgccaagattttcaacatataccctcggaaaggagcaattctggaagga
tctgatgcagatattatcatcctgaatcccgagaggagctttgtcatgggtgcccacaca
caccattcaaggtccaacacaaatgtgtacgagggcaggaaaggaaagggaatggtagaa
gtcacgatctcaagagggcgagttgtgtgggaggatggcattctgaacgttgttcccggt
tcaggaagatacgtcagaacaccgccttacagctacctgtttgatggcattgaaaagtca
gacgctgcctacagagcctcccttcgtgcccctgtgaaacgtggcaaggctgctgcttaa

DBGET integrated database retrieval system