KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327706
Entry
4327706           CDS       T01015                                 
Name
(RefSeq) replication protein A 14 kDa subunit
  KO
K10740  replication factor A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4327706
   03420 Nucleotide excision repair
    4327706
   03430 Mismatch repair
    4327706
   03440 Homologous recombination
    4327706
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4327706
   03400 DNA repair and recombination proteins [BR:osa03400]
    4327706
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4327706
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4327706
   MMR (mismatch excision repair)
     4327706
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4327706
SSDB
Motif
Pfam: Rep_fac-A_3
Other DBs
NCBI-GeneID: 4327706
NCBI-ProteinID: XP_015626750
UniProt: Q9SDK9
LinkDB
Position
1:complement(8396498..8398632)
AA seq 106 aa
MDTSGPAAFVNGEILKMFVGRRVRTVVQAQREEGGLLIGQSTDGHQLTIKGASGAPMSHY
VEIIGIAEPNQAIRAEVCTDFGENFDPAPFNGLCKLANGQMKDLFL
NT seq 321 nt   +upstreamnt  +downstreamnt
atggatacatcaggacctgcagcattcgtcaatggagagattctgaagatgttcgtcggc
cgaagagtgcgcacggtggtccaagcccagcgcgaggaaggcgggttgcttatcgggcag
tccaccgatggtcatcagctaaccatcaaaggggcctccggtgcccctatgtcgcactat
gtggagattattgggatcgctgaacccaatcaggccatccgggctgaagtttgcacagat
tttggtgaaaacttcgatcctgcaccattcaatggactgtgcaagcttgcgaatggccag
atgaaggatttgttcctgtag

DBGET integrated database retrieval system