KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327802
Entry
4327802           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-processing protein 40A isoform X1
  KO
K12821  pre-mRNA-processing factor 40
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4327802
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4327802
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    4327802
 Complex B
    4327802
SSDB
Motif
Pfam: FF WW
Other DBs
NCBI-GeneID: 4327802
NCBI-ProteinID: XP_015620888
LinkDB
Position
1:complement(19178274..19192315)
AA seq 992 aa
MASNMQPSGPPQQSRPPMMGSSVPPQNLGPPMPMQFRPVIHQQQPPQFMQPGQQFRPVGQ
AMPGANIGMPGQMPHFQQPTQHLPHSGQVPPASQAVPMAYQPARPMSSGPLQPPATFSGG
HMPTMGGPIPPPSYTATLQYQPSSVPPPIVQSWGTAPGQNVPLVQPGHQPMSSSATMPSI
NSSETSSSDWQEHTSADGKKYYYNKKTRQSSWEKPAELMTPLERADASTEWKEFTTQEGR
KYYYNKVTKQSKWTIPDELKIARELAEKASNPRPDQETETTAGAPSGPTSNSVEPSSVPA
NQSSTTIMGAPSTLDAAANSVPPGAGPSHNMENTSSSSNTAMQNGGPSTVVTPVISTEIP
SVASDAGISRANNEYPSLASTADTQNGASAEELEEAKKTMAVPGKINVTPVEDKTSEEEP
VTYANKLEAKNAFKALLESSNVESDWTWDQAMRVIINDKRYGALKTLGERKQAFNEYLNQ
RKKLEAEERRIKQRKARDDFLAMLEESKELTSSTRWSKAITMFEDDERFSAVERPRERED
LFESYLMELQKKERARAAEEHKRHIAEYRAFLESCEFIKTSTQWRKVQERLEDDERCSRL
EKIDRLEIFQEYIRDLEKEEEEHKRIHKEQVRRQERKNRDEFRKMLEEHVAEGMLTAKTR
WRDYCAQVKDSSVYLAVASNISGSMPKDLFEDVMEELEKQYQDDKARIKEAVKSGKIPMT
TSWTLEDFETAVTEDDTLKGITNINMKLIFDDQVERLREKEVKEAKKRQRLGENFSDLLY
SIKEISASSTWDDSKALFEDSQEYKALDSETYSRELFEECVVHLKERLKEKERLREEEKA
RKEKEREEKERRKEKEKKEKERKEKERDKEKEREKDKGKDRSRKDEMDIDAVDADSHGSK
DKKREKDKEKKHKRHHHDTADDVSSERDEKDDSKKSRRHSSDRKKSRKHTHASDSDSENR
HKRHKKDRDSSRRNGTRDDLEDGELGEDGEIH
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggcaagtaatatgcaaccttctgggccaccgcagcaatctaggccccctatgatgggc
tctagtgtcccaccacaaaatctgggacctccgatgcctatgcagtttaggccggtgatt
catcagcaacaacctcctcagttcatgcaaccggggcagcagtttcgacctgttggtcag
gccatgccaggagctaatattggcatgccaggtcagatgccacattttcagcaacctaca
cagcacttgcctcactctggtcaagttccacctgcatcacaagcagttcctatggcttat
cagccagctagacctatgtcatctgggcctctgcagccgccagcgacattctctggaggc
catatgcccaccatgggaggccctataccgcctccatcctatacggctacactgcagtat
caaccatcatctgttcctcctcccatagtgcaatcttggggtacagctccaggtcagaat
gtacctcttgtgcagcctgggcatcagccgatgtcatcttccgctacaatgccttcaatc
aattccagcgaaactagctcttcagactggcaagagcacacttcagctgatgggaaaaag
tactactataataagaagacaaggcaatcaagttgggagaaacctgctgagttgatgaca
ccgttggagagagctgatgcctctactgaatggaaagaatttactacacaagagggtcga
aagtactattacaataaggtgacaaagcaatccaaatggacgattccagatgagttaaag
attgcgcgtgaattagcagagaaggcgtcaaatccacgccctgatcaagaaacggaaaca
actgctggtgctccttctggacccacttcaaactctgtggaaccttcttctgtacctgct
aaccagtcctccacaacgattatgggtgctccaagtacacttgatgcagcagcgaactct
gttcctcctggtgctggcccttcgcacaatatggagaacacctccagttcatctaatact
gccatgcaaaatggtggtccaagtaccgttgttactcctgttataagcacagaaattcca
tcagttgcaagtgatgcagggattagcagagccaataacgaatacccatctctagctagc
actgctgacactcaaaatggagcatctgctgaagaattggaggaggccaaaaagaccatg
gcagttccagggaagatcaatgttactccagtagaagacaaaactagtgaagaagaacct
gtgacctatgctaataagttggaagctaaaaatgcgttcaaagctctgcttgaatcatca
aatgttgagtctgattggacatgggatcaggctatgagggtcatcataaatgacaaaagg
tatggtgccctcaaaactcttggggagaggaagcaagcttttaatgagtatctaaaccag
aggaaaaagcttgaagcagaagaaagacgtatcaaacagcggaaggcacgtgatgatttt
ttagctatgctagaagaatctaaggagcttacttcatcaacaagatggagtaaagcaata
actatgtttgaggatgatgaacggtttagtgctgttgagcgtccaagggagcgtgaagac
ttatttgagagctatcttatggaactacagaagaaggaaagagccagggctgctgaagag
cacaaaaggcacatagcagaatatagagcttttctcgagtcatgtgaattcataaagaca
agtacccagtggagaaaagttcaagaacgtcttgaggatgatgaacgctgttcccgactt
gaaaagatcgatcgactggagattttccaagagtatataagggatctggagaaagaagag
gaagagcacaagcggatacataaggaacaagtaaggaggcaagagcgcaaaaatcgtgat
gaatttcgcaagatgttggaagaacatgtagctgaaggaatgcttactgcaaaaactcgt
tggcgtgattactgtgcccaggttaaagattcctctgtgtacttggctgtggcctcgaac
ataagtggttcaatgccaaaagatctgtttgaagatgtaatggaggagcttgagaaacag
tatcaagatgacaaagcccgaattaaagaagcagtgaagtctggaaagattcctatgacg
acttcatggacactagaggatttcgaaactgctgttacggaggatgatactttgaaagga
ataacaaacataaacatgaagcttatttttgatgatcaagttgaaaggctcagggaaaag
gaggtaaaggaagcaaagaagcgccagcgtctgggtgaaaatttctcagatcttttgtac
tcaatcaaggaaatatcagcttcttcaacatgggatgattctaaagcactattcgaagat
agccaagagtacaaggcattggacagcgaaacatactctagagagcttttcgaagagtgc
gttgtccacttgaaagaaaggttaaaagagaaagagcgcttgagggaggaagaaaaggca
agaaaagagaaggaacgtgaagagaaagaacggaggaaagagaaagaaaagaaggagaaa
gaacgcaaagaaaaagaaagagacaaggagaaagaaagagaaaaggacaaaggaaaggat
cggtcgaggaaagatgagatggatattgatgctgttgatgcagatagccatggctcaaaa
gacaagaaaagagaaaaggacaaggaaaagaagcataagagacaccaccatgacactgca
gatgatgtgagctctgaaagggatgagaaggatgactctaaaaagtctcgtagacatagc
agtgatcgcaagaaatcaaggaagcatacccatgcttcggactctgatagtgaaaatcgg
cacaaaagacacaaaaaggatcgagatagctcccgcagaaatggcacacgtgatgacctt
gaagatggtgaacttggagaagatggggagattcattag

DBGET integrated database retrieval system