KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327859
Entry
4327859           CDS       T01015                                 
Name
(RefSeq) 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal
  KO
K01661  naphthoate synthase [EC:4.1.3.36]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00932  Phylloquinone biosynthesis, chorismate (+ phytyl-PP) => phylloquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4327859
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.36  1,4-dihydroxy-2-naphthoyl-CoA synthase
     4327859
SSDB
Motif
Pfam: ECH_1 ECH_2 SDH_sah Carboxyl_trans Peptidase_S49
Other DBs
NCBI-GeneID: 4327859
NCBI-ProteinID: XP_015631022
UniProt: A0A0P0V674
LinkDB
Position
1:complement(27050872..27054617)
AA seq 331 aa
MDAAGRRLARVTAHLLPSSLPLPLASAPTLAPSPAASPASDSYRRVHGDVPSEPPEWRAA
TDESGKGFVDILYDKAVGEGIAKITINRPDRRNAFRPLTVKELMRAFEDARDDSSIGVII
LTGKGTQSFCSGGDQALRDADGYVDFDSFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGG
HVLHMVCDLTIAADNAIFGQTGPKVGSFDAGYGTSIMSRLVGPKKAREMWFLSRFYTADE
ADRMGLVNVVVPLADLERETVKWCRKILRNSPTAIRVLKSALNAADDGHAGLQELGGNAT
LIFYGTEEAKEGKNAYMERRRPDFSKFPRKP
NT seq 996 nt   +upstreamnt  +downstreamnt
atggacgcggcggggaggaggctcgcccgcgtcacggcccacctcctgcccagctccctc
ccgctcccgctcgcctccgcccctaccctcgcgccttcccccgccgcgtcgccagcgtcg
gacagctaccgacgggtccacggcgacgtgccgtcggagcccccggagtggcgcgcggcg
acggacgagtccgggaagggcttcgtggacatcctctacgacaaggccgtcggcgagggc
atcgccaagatcacaataaaccgccctgatagaaggaatgcattccgacccctgaccgtg
aaggagcttatgcgtgctttcgaggatgctagagatgatagttcaatcggagtcatcata
ctaacagggaaggggacccagtccttctgtagcggcggtgaccaggcgttaagggatgct
gatggatatgttgattttgatagctttggcaggctcaacgtcctagacctccaggtgcaa
atacggcgccttccaaagcctgttatagcaatggttgctggttatgctgttggaggaggc
catgtgttgcacatggtgtgtgatctaacgattgcagctgacaatgcaatttttgggcag
acaggtcctaaggttggaagcttcgatgctggctatggcacttcaattatgtctcggttg
gtaggaccaaagaaagctcgtgagatgtggtttctgtcacggttctacacagctgatgag
gcagacagaatgggtctcgtcaatgtagtagtaccactcgctgatttggagcgagaaacg
gtgaaatggtgccgaaaaatcttgaggaacagtccaacagccatccgggtgctgaaatct
gcactcaatgcagctgatgatggccatgctggccttcaggagctcggtggcaatgcgaca
ctgatcttctatggaactgaagaggcaaaagaaggcaaaaatgcatacatggagcgacgg
cgccctgatttctcaaagttccctcggaagccttaa

DBGET integrated database retrieval system