KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327968
Entry
4327968           CDS       T01015                                 
Name
(RefSeq) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4327968
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     4327968
SSDB
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-GeneID: 4327968
NCBI-ProteinID: XP_015622133
UniProt: Q8S2G0
LinkDB
Position
1:33971170..33976465
AA seq 401 aa
MACSTHLLSQSLYPLNRANPAAARGHLRFQASPSVRLGSGTSRRRALGLRVAASAEQGRR
QVEVEYDLQAKFNKLADQIDQNAGITRLNLFSPCKINVFLRITGKRPDGFHDLASLFHVI
SLGDTIKFSLSPSKSKDRLSTNVAGVPVDESNLIIKALNLYRKKTGTDNFFWIHLDKKVP
TGAGLGGGSSNAATALWAANQFSGCIASEKELQEWSGEIGSDIPFFFSQGAAYCTGRGEI
VEDIRNPLPANLPMVLVKPPEACSTAEVYKRLRLEHTSQTDPLVLLKEITENGISQDACV
NDLEPPAFEVLPSLKRLKKRIIAANRGDYDAVFMSGSGSTIVGIGSPDPPAFVYDDDDYK
DTFVSEACFLTRNENEWYREPISSKITSEEDLPPEVASVSD
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcttgctccacccacctcctgtcccagagcctctacccgctcaaccgcgctaacccg
gcagccgcgcgcgggcacctccggttccaggcttctcccagtgtgaggctcggctccggc
accagtcgccgccgggcgctgggcctgagagtcgccgcgtcggcggagcaagggaggagg
caagtggaggttgagtatgatctacaagcaaagttcaacaagctagcggaccaaattgac
cagaatgctgggattacacggctgaacctattctcaccttgcaaaattaatgtgttcttg
aggataacgggtaagagaccagatgggttccatgacctggcttctctgtttcatgtgata
agtttgggtgatactatcaaattctcattgtcaccaagtaagagcaaagatcgcttgtca
accaatgtagcaggtgtcccagttgatgaaagcaatttgatcatcaaggcactcaatctt
taccgcaagaaaactggaactgacaactttttttggattcatcttgataagaaggtccct
actggtgctggtcttggtggtggaagcagtaatgctgcaactgcgctgtgggccgccaac
cagtttagtggctgcattgcttcagaaaaggagcttcaggagtggtctggagagatagga
tcggatattcccttcttcttttcacaaggagcagcgtattgtaccggtagaggagagatt
gttgaagatattcggaatccattgccagcaaatttgccgatggtactagtaaagccacct
gaagcatgctcaacagctgaagtttacaagcggctcaggttagagcacacaagtcaaact
gatcccttggtattgctcaaggaaattactgaaaatgggatatcacaggatgcctgtgtt
aatgatctagaacctccagcatttgaggtgttgccatcactaaagaggttgaagaaacgt
ataattgctgctaaccggggagattatgatgctgtttttatgtcaggaagtggaagcaca
attgttgggattggttcaccagatccgcctgcatttgtgtatgatgatgatgactacaag
gatacttttgtgtcagaggcctgcttcctcactcgtaatgagaacgagtggtacagagaa
ccaatctcatcgaaaatcactagcgaggaagatttacctccggaggtagcatcagtttct
gactga

DBGET integrated database retrieval system