KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327981
Entry
4327981           CDS       T01015                                 
Name
(RefSeq) glycerate dehydrogenase
  KO
K15893  glycerate dehydrogenase [EC:1.1.1.29]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4327981
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4327981
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     4327981
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AlaDh_PNT_C NAD_binding_2
Other DBs
NCBI-GeneID: 4327981
NCBI-ProteinID: XP_015625167
UniProt: Q6YU90 B9F1N6
LinkDB
Position
2:complement(79726..82953)
AA seq 386 aa
MAKPISIEVWNPSGKYRVVSTKSMPGTRWIRLLADNDCRLEICTETKTILSVDDILALIG
DRCDGVIGQLTEEWGEVLFSALKRAGGTAFSNMAVGYNNVDVEAANRNGIAVGNTPGVLT
ETTAELAASLSLAAARRIVEADQFMRAGLYDGWLPHLFVGNLLKGQTVGVIGAGRIGSAY
ARMMIEGFKMNLIYYDLYQSTRLEKFVTAYGQFLKANGEQPVTWKRAATMEDVLREADVI
SLHPVLDKTTYHLINPERLAIMKKEAVLVNASRGPVIDEVALVEHLKANPMFRVGLDVFE
DEPYMKPGLADMKNAVVVPHIASASKWTREGMATLAALNVLGKIKGYPVWGNPNLVEPFL
KEDATPPAACPSIVNAKQLGLPSSKL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggcgaagccgatatcgatcgaggtgtggaatccgagcggaaagtatcgcgtggtgagc
accaagtccatgcccggcacccgctggatccgcctcctcgccgacaacgactgccgcctc
gagatctgcacggagacgaagaccatcctctctgtcgacgacatcctcgccctcattggc
gatcgctgcgatggtgtcatcggccagctgacggaggagtggggagaggtgctgttctcg
gcgctgaagcgcgccggcggaacagccttcagcaacatggccgtcgggtacaacaacgtc
gacgtggaggccgccaataggaacggcatcgccgtcggcaacacgcctggcgttctgacg
gagacgacggcggagctggccgcgtctctgtcgctggcggcggcgcggaggatcgtggag
gcagatcagttcatgagggctggcctctacgacggatggctcccgcacctgttcgtgggg
aacttgctcaagggtcagactgtgggagtcatcggagctggtcgaatcggctcagcttac
gcaagaatgatgatcgagggcttcaagatgaacttgatctactacgacctgtatcagtcc
acgcgccttgagaaattcgtcacagcttacgggcagttcctgaaagcaaacggagagcag
cctgtgacatggaagagagccgccaccatggaggatgtcctcagggaggccgacgtgatt
agtctgcaccctgtgttggacaagaccacttaccatctgataaacccggaaaggctggcc
atcatgaagaaggaagcggttcttgtgaatgcaagtcgaggaccggtgattgatgaggta
gcactggtggagcacctcaaggccaaccccatgttccgcgtcggtcttgatgtgtttgag
gatgagccttacatgaagcccggcctcgctgacatgaagaatgccgtcgtcgtacctcac
atcgcatctgcctccaagtggacgcgcgaaggaatggcaacacttgctgctctaaacgtt
cttggcaagatcaagggttatccggtttgggggaacccgaatctagtggagccatttctc
aaggaggatgcaacgccgccagctgcttgccccagcattgttaatgccaaacaactcggc
ctgccatcgtcaaagctctaa

DBGET integrated database retrieval system