KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327989
Entry
4327989           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4327989
  KO
K02988  small subunit ribosomal protein S5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327989
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327989
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4327989
  Bacteria
    4327989
  Archaea
    4327989
SSDB
Motif
Pfam: Ribosomal_S5_C Ribosomal_S5 MtrG
Other DBs
NCBI-GeneID: 4327989
NCBI-ProteinID: XP_015626805
UniProt: Q6YU81 Q6ZFK6
LinkDB
Position
2:complement(127073..130191)
AA seq 501 aa
MASSAAARSRAAASAAWARLLSLRPSPPVSSTHHLTLRIASPRRHFAFSANASSGSSRLK
QIQSERVIHDLFAELQRERQRDRQEEDEDEGEDEDYLGVKPLIEKLERRRAKEEAAPDDS
FWEPTDSDSDEEDERYTPDAIKRRVDEFERKCNRHSELLRSFAEAETLDDAHKWMTKIDR
FEERHLKLPLEYRVIGDMMNRLKDATGKDRFLLLQKLNRAVRIMECREAYDPSNPSNFGV
IQHQQVGSPEDLVLNAGFDREKQMIQGAGDDDDDEEFNEDKEKDDLLIEKLNSIEKKIEE
KLAELDHTFGKKGRVLEEEIKDLVEERNSLTEHKRRPMYRKGFDVKVIDVNRTCKVTKGG
QIAKFTALLATGNYHGVVGFAKARGPTAKIAIQRAYEKCFQDLHYMERYEDHTIAHAIQA
KYEKTKIYLWPGPMRSGMSAAGRTVETVLYLAGFSNVKSKIIGSRNPLNVIKALFIALNA
IETPKDVEQKFGRTVVESYLL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcctcctccgccgccgcccggtcccgcgccgccgcctccgccgcgtgggcgcgcctc
ctctccctgcgccccagccctcccgtatcctccacccaccatctaaccctgcggatcgcc
tcccctcgccgccacttcgccttctccgccaacgcctcctccggcagctctaggctcaag
cagatccagagcgagcgggtcatccacgacctcttcgccgagctccagcgagagcgccag
cgggaccgccaggaggaggatgaggatgagggtgaggatgaggactacctgggcgtcaag
ccgctcatcgagaagctcgagcgccgcagggccaaggaggaggccgcgccggacgattcc
ttctgggagcccaccgactccgacagtgacgaggaggacgagcgctacacccctgacgcc
atcaagcgccgcgtcgacgagttcgagcgcaagtgcaaccgccactccgaactcctacgc
tccttcgccgaagccgaaacccttgacgatgcccacaaatggatgaccaagatcgacaga
ttcgaggagcgccatttgaagcttccactggagtacagagtcatcggcgacatgatgaac
cgcctcaaagatgccaccggcaaggaccgctttcttctcctccagaagcttaaccgagct
gttagaatcatggaatgcagggaagcatacgatcccagcaacccctccaatttcggggtc
atccaacaccagcaggtcggctctccggaggatcttgtgctcaatgctggctttgacagg
gagaagcagatgatccaaggggctggtgacgacgacgacgacgaggaattcaatgaagac
aaggagaaggatgatctgctcatagagaagttgaattctatcgaaaagaagatcgaggag
aaattagctgagttagatcatacgtttggtaagaagggcagagttctagaggaggaaatt
aaggatcttgttgaagagcgcaactccctcacggagcataagaggagacctatgtacagg
aaaggttttgacgtcaaggtcattgatgttaatcggacgtgtaaagtcacaaagggaggc
caaatagcaaaattcacagcattgttagcgactggaaactaccatggtgttgtaggattt
gcaaaagctagaggtccgacagccaagattgcaattcaaagggcttatgagaaatgcttc
caggacctccattacatggagcgatatgaggaccacacaattgctcatgcaattcaggcc
aaatatgagaagacaaagatatacctctggcctggaccaatgagaagtggaatgtctgct
gctggtaggacggttgaaacagtactgtatttagctggtttcagcaacgtcaagtcaaag
attattggttcaaggaaccccctgaatgttatcaaagctctcttcatagcattaaacgcc
attgaaacgccaaaggatgttgagcagaagtttgggcggaccgtggttgagtcatactta
ttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333233
Entry
4333233           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S5, chloroplastic
  KO
K02988  small subunit ribosomal protein S5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333233
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333233
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4333233
  Bacteria
    4333233
  Archaea
    4333233
SSDB
Motif
Pfam: Ribosomal_S5 Ribosomal_S5_C
Other DBs
NCBI-GeneID: 4333233
NCBI-ProteinID: XP_015633084
UniProt: Q850W6 B9F990
LinkDB
Position
3:complement(19413023..19417103)
AA seq 326 aa
MAATSSTASAMAVAATSPTIATAPFSSLPLRLRLRPKPLLFTSRLLLPVPKSSSWVESVS
EEGEEEGVEEDSEESGAAGEDDDGEDNDEKPRPEPVAASGFEFASPPEGYVEPAPFDELP
PESPEDVAAAYEALYGPAFSGETVMGNNVFEVKVVDPVDMDREQRPSDEFSERVVQVNRV
TKVVKGGRQLSFRAIVVVGDMKGHVGVGVGKAKEVTEAITKAAMNGRRNLVTVPLTKYST
FPHRADADYGAARVMLRPACPGSGVIAGGAVRVVLEMAGVENALGKQLRSKNPLNNARAT
IKATQMMRQFKDVAAERGLPMEQLWK
NT seq 981 nt   +upstreamnt  +downstreamnt
atggccgccacctcctccaccgcctccgccatggcggtggccgccacctcccctaccatt
gccactgcgccattctcgtctcttcctctccgccttcgcctccgccccaaacccctcctc
ttcacttctcgcctcctcctccccgtccccaagtcctcctcctgggttgaatccgtctcg
gaggaaggggaggaagaaggcgtggaggaggattccgaggaatccggtgccgcgggggaa
gacgatgacggggaggacaacgacgaaaagccgcggcctgagccggtggccgcctctggg
ttcgagttcgcgtcgccgccggagggctacgtggagccggccccgttcgacgagctgccc
ccggagtcgcccgaggacgtggcagcggcgtacgaagcgctctacgggccggcctttagc
ggcgagacggtcatgggcaacaacgtcttcgaggtcaaggtggtggatcccgtcgacatg
gaccgggagcagcgccctagcgacgagttcagcgagcgggtcgtgcaggtcaatcgcgtc
accaaggtcgtcaagggcgggaggcagttatccttccgtgcgatcgtcgtcgtcggcgac
atgaagggccacgtcggtgtgggcgttggcaaggccaaggaggtcaccgaggccatcacc
aaggccgccatgaacggccgtcgcaatctcgtcaccgtgccgctcaccaagtattcgacc
ttcccgcatagagcagatgcagactatggagcagccagggtcatgttgaggcctgcttgc
cctggatctggtgtaattgcaggtggagctgtgagggtcgtgctggagatggctggggtt
gaaaatgctctggggaaacagctgaggagcaagaaccccctcaacaatgcaagagctacc
atcaaggcgacccaaatgatgaggcagttcaaggatgttgctgcagagcgcgggcttcca
atggagcagctatggaaataa

DBGET integrated database retrieval system