KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328006
Entry
4328006           CDS       T01015                                 
Name
(RefSeq) putative nitric oxide synthase
  KO
K13427  nitric-oxide synthase, plant [EC:1.14.13.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4328006
   00330 Arginine and proline metabolism
    4328006
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4328006
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:osa03009]
    4328006
   03029 Mitochondrial biogenesis [BR:osa03029]
    4328006
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     4328006
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   4328006
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4328006
SSDB
Motif
Pfam: MMR_HSR1 RsgA_GTPase S_layer_C PduV-EutP Methyltransf_13
Other DBs
NCBI-GeneID: 4328006
NCBI-ProteinID: XP_015626850
UniProt: Q6YPG5
LinkDB
Position
2:261330..265460
AA seq 547 aa
MAAPPLLSLSQRLLFLSLSLPKPQLAPNPSSFSPTRAASTAPPPPEGAGPAAPSRGDRFL
GTQLAAEAAARVLAPEDAERRRRRREKRKALARKPSAAACYGCGAPLQTADEAAPGYVHP
ATYDLKKRHHQLRTVLCGRCKLLSHGHMITAVGGHGGYPGGKQFVSADQLRDKLSYLRHE
KALIIKLVDIVDFNGSFLARVRDFAGANPIILVITKVDLLPRDTDLNCIGDWVVEAVVKK
KLNVLSVHLTSSKSLVGVTGVISEIQQEKKGRDVYILGSANVGKSAFISAMLRTMAYKDP
VAAAAQKYKPIQSAVPGTTLGPIQIEAFLGGGKLYDTPGVHLHHRQAAVIHADDLPSLAP
QSRLRARCFPANDTDVGLSGNSLFWGGLVRIDVVKALPRTRLTFYGPKKLKINMVPTTEA
DEFYEREVGVTLTPPAGKEKAEGWVGLQGVRELQIKYEESDRPACDIAISGLGWVAVEPL
GVPSSNPDESAEEEDNESGELHLRVHVPKPVEIFVRPPLPVGKAASQWYRYQELTEEEEE
LRPKWHY
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggcggcgcctcctctgctgagcctgagccagcggctactcttcctctccctctccctc
cccaagccacagctcgcccccaacccctcctctttctcccccacgcgcgccgcctccacc
gccccgccacctccggaaggggcgggccccgccgcgccatcccgcggggaccgcttcctc
ggcacccagctcgcggccgaggccgccgcccgcgtcctcgctccggaggacgccgagagg
cgccgccgccgccgggagaagcgcaaggccctcgcgcggaagccctccgccgccgcctgc
tacggctgcggcgcgccgctgcagacggccgacgaggccgcgcccggctacgtccacccc
gccacctacgacctgaagaagagacaccatcagctgagaaccgtgctatgtgggagatgc
aagctcttgtctcatggccacatgatcactgctgttggtggccatggcggctatcctgga
gggaagcagttcgtttccgcggaccaactcagggacaagctctcctaccttcgtcatgag
aaagctttgattatcaagctggttgacatagttgacttcaatgggagcttcctggcgcgt
gtgcgcgattttgctggtgctaatcctattatactagtcatcacaaaggttgatctcctt
cctagagatacagatttgaattgcattggcgactgggttgttgaggcagttgtcaagaag
aagctcaacgtacttagtgtccatttgacaagctcaaagtcactcgttggcgtcactggg
gttatatcagagattcagcaggaaaagaagggccgagatgtatatatactgggttcagca
aatgttgggaaatctgcatttataagtgctatgctaaggacgatggcatataaggatcca
gtggcagctgcagctcaaaaatacaagccgatacaatctgctgttcctggaacgaccctt
ggtcctattcaaattgaagcatttttaggaggcgggaaattatatgatacacctggagtc
catcttcaccaccggcaagcagcagttatccatgctgatgatctgccttctcttgcacca
caaagtcgtctaagggcacggtgttttcctgctaatgatacagatgttggattgagtggg
aattcattattctggggtggactagtccgtattgatgttgtcaaggctcttccacgcaca
cgactgacgttctatggacccaagaagctaaagattaatatggtcccaaccacagaagca
gatgaattttatgagagagaagttggagttacattgactcccccagctggcaaagagaag
gctgaaggatgggttggtctgcagggtgttcgtgagttgcagataaaatacgaagagtct
gatagacctgcttgtgacattgcaatttctggtctcgggtgggttgcggttgagccactt
ggtgtgccatcaagcaacccagatgagagtgctgaggaagaagacaatgagagtggtgaa
ctgcatttgagagtacatgttcccaagcctgttgagatctttgtccgacctccattgcct
gttggtaaagcagcatcgcaatggtacagataccaggagttgaccgaggaagaagaggag
ttgagacctaaatggcattactga

DBGET integrated database retrieval system