KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328034
Entry
4328034           CDS       T01015                                 
Name
(RefSeq) diphosphomevalonate decarboxylase
  KO
K01597  diphosphomevalonate decarboxylase [EC:4.1.1.33]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4328034
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.33  diphosphomevalonate decarboxylase
     4328034
SSDB
Motif
Pfam: MDD_C GHMP_kinases_N
Other DBs
NCBI-GeneID: 4328034
NCBI-ProteinID: XP_015626691
UniProt: Q6ETS8 B9F1R7
LinkDB
Position
2:complement(496749..501026)
AA seq 421 aa
MAAAEEGQWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVS
PSFPSDRMWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASF
NNFPTAAGLASSAAGLACFVFTLGKLMNVKEDHGELSSIARQGSGSACRSIYGGFVKWCM
GKNNDGSDSIAVQLADEAHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQTV
VPERVLKMEEAIKSRNFESFARLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWN
QSEGTPQVAYTFDAGPNAVLIAPNRKNATILLQKLLYYFPPQDNDLSSYMVGDKSILSDA
GLKSIEDVEALPAPAETKMPSQKFKGDVSYFICSRLGAGPKVVTDESLALIDSVTGLPKG
V
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcggcggcggaggaggggcagtgggtgctcatggccaccggccgatctcccaccaac
atcgccgtcatcaagtactgggggaagagggacgaggcgctcatcctccccgtcaacgac
agcatcagcgtcaccctcgaccccgaccacctctccgccaccaccaccgtcgccgtcagc
ccttccttcccctccgaccgcatgtggctcaacggcaaggagatctccttgtcaggaggg
aggtttcagagctgcctgagggagatccggaagcgtgctcaagatgtcgaggatgagaag
aaggggatcaggatcaagaaagaggactgggggaagctacatgtacacatagcatcgttc
aacaacttccccactgctgctggtttggcctcttcggctgctggcttggcttgttttgtt
ttcacccttggaaagctaatgaatgtgaaagaagatcatggtgaactttcttccatagca
aggcaagggtctggaagtgcatgccgcagtatatatgggggattcgtgaaatggtgtatg
ggaaaaaataatgatggaagcgacagcatagctgtacaacttgctgatgaggcacactgg
aatgatcttgttattatcatagcggtggtcagttcaaagcagaaggaaacaagtagcact
agtgggatgcgagacagtgttgaaacaagtccccttttgcaatatagggcccagactgta
gttccagaacgggtgttgaaaatggaagaggctatcaagtctcgtaattttgagtccttt
gccaggttaacttgtgcagatagcaaccaatttcatgctgtatgtttggacacgagccct
cccatcttctatatgaacgatacatcacacaggataattagccttgtggagaagtggaac
cagtcagaaggaaccccacaggttgcttacaccttcgatgctgggcccaatgctgtccta
atcgcaccaaaccgcaaaaatgcaaccattctccttcagaagctcttgtattatttccct
cctcaagataatgatctcagcagctatatggttggcgacaagtcgattctaagcgatgct
ggactgaaatcgatagaagatgtggaggccctcccagctcctgccgagacgaagatgccg
agccaaaaattcaagggagatgtgagctacttcatctgtagcaggcttggagctggccca
aaagttgtcactgacgaaagcctagcattgatcgattcggtcacggggctccccaaggga
gtgtag

DBGET integrated database retrieval system