KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328040
Entry
4328040           CDS       T01015                                 
Name
(RefSeq) probable inactive linolenate hydroperoxide lyase
  KO
K10528  hydroperoxide lyase [EC:4.1.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4328040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4328040
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.-
     4328040
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP74 family
   4328040
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4328040
NCBI-ProteinID: XP_015626416
UniProt: Q6Z8Z7 A0A0P0VDY8
LinkDB
Position
2:554493..556324
AA seq 487 aa
MVPSFPQPASAAAATRPIPGSYGPPLLGPLRDRLDYFWFQGPDDFFRRRAADHKSTVFRA
NIPPTFPFFLGVDPRVVAVVDAAAFTALFDPALVDKRDVLIGPYVPSLAFTRGTRVGVYL
DTQDPDHARTKAFSIDLLRRAARNWAAELRAAVDDMLAAVEEDLNRAPDPAAASASYLIP
LQKCIFRFLCKALVGADPAADGLVDRFGVYILDVWLALQLVPTQKVGVIPQPLEELLLHS
FPLPSFVVKPGYDLLYRFVEKHGAAAVSIAEKEHGISKEEAINNILFVLGFNAFGGFSVF
LPFLVMEVGKPGRDDLRRRLREEVRRVLGGGDGGEAGFAAVREMALVRSTVYEVLRMQPP
VPLQFGRARRDFVLRSHGGAAYEVGKGELLCGYQPLAMRDPAVFDRPEEFVPERFLGDDG
EALLQYVYWSNGPETGEPSPGNKQCAAKEVVVATACMLVAELFRRYDDFECDGTSFTKLD
KRELTPS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggtgccgtcgttcccgcagccggccagtgcggcggcggcgacgcggccaataccgggg
agctacggcccgccgctgctcggcccgctccgcgaccgcctcgactacttctggttccag
ggccccgacgacttcttccgccgccgcgccgccgaccacaagagcaccgtgttccgcgcc
aacatcccgcccaccttccccttcttcctcggcgtcgacccgcgcgtcgtcgccgtcgtt
gatgccgccgccttcaccgcgctcttcgacccggccctcgtcgacaagcgcgacgtcctc
atcggcccctacgtccccagcctcgccttcacccgcggcacccgcgtcggcgtctacctc
gacacccaggaccccgaccacgcccgcaccaaggccttctccatcgacctcctccgccgc
gccgcccgcaactgggccgccgagctccgcgccgccgtcgacgacatgctcgccgccgtc
gaggaagacctcaacagggcccctgaccccgccgccgcctccgccagctacctcatcccg
ctccagaagtgcatcttccgcttcctctgcaaggcgctcgtcggcgccgacccggcggcg
gacggcctcgtcgaccgcttcggcgtgtacatcctcgacgtgtggctggcgttgcagctg
gtgccgacgcagaaggtgggcgtcatcccgcagccgctggaggagctcctgctccactcc
ttcccgctgccgtcgttcgtcgtcaagcccgggtacgacctcctctaccgcttcgtggag
aagcacggcgccgccgccgtgtccatcgctgagaaggagcacggcatcagcaaggaggag
gccatcaacaacatcctcttcgtgctcggcttcaacgcgttcggcggcttctcggtgttc
ctgccgttcctggtcatggaggtcggcaagcccggccgggacgacctgcggcggcggctg
cgggaggaggtgcgccgcgtgctgggcggcggcgacggcggcgaggccgggttcgcggcg
gtgagggagatggcgctggtgcggtcgacggtgtacgaggtgctccggatgcagccgccg
gtgccgctgcagttcgggcgggcgcggcgagacttcgtgctgcggtcgcacggcggcgcg
gcgtacgaggtgggcaagggcgagctgctgtgcgggtaccagccgctggccatgcgcgac
ccggcggtgttcgaccggccggaggagttcgtgccggagaggttcctcggcgacgacggc
gaggcgctgctgcagtacgtgtactggtccaacgggccggagaccggcgagccgtcgccg
gggaacaaacagtgtgccgccaaggaggtggtcgtcgccaccgcgtgcatgctcgtcgcc
gagcttttccggcggtacgacgacttcgaatgcgacggcacctccttcaccaagctcgac
aagcgggagctcactcccagctaa

DBGET integrated database retrieval system