KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328083
Entry
4328083           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase II subunit 4
  KO
K03012  DNA-directed RNA polymerase II subunit RPB4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4328083
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4328083
   03400 DNA repair and recombination proteins [BR:osa03400]
    4328083
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     4328083
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4328083
SSDB
Motif
Pfam: RNA_pol_Rpb4
Other DBs
NCBI-GeneID: 4328083
NCBI-ProteinID: XP_015627142
UniProt: Q6ZGM1 A3A2G2
LinkDB
Position
2:complement(894681..895728)
AA seq 142 aa
MSGEEEENAAELKIGEEFLKAKCLMNCEVAIILEHKYEQIQHMSDGDPSSQVSQVFEKSL
QYVKRFSRYKNPDAVRQVRETLSRYGLAEFELCTLGNLCPDTSDEASALVPSLRSGGRFV
GDPGSEKIDKMLNDLSLIKKFE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgtccggcgaggaggaggagaacgcggcggagctcaagatcggggaagagttcttgaag
gccaagtgcctgatgaactgcgaggtggcgataatcctggagcacaagtacgagcagatc
cagcacatgtcggacggggacccgtcgtcgcaggtgtcgcaggtgttcgagaaatcgctg
cagtacgtgaagcggttcagccggtacaagaacccggacgcggtgaggcaggtgagggag
acgctgagccgctacggcctcgccgagttcgagctctgcaccctcggcaacctctgcccc
gacaccagcgacgaggcctccgccctcgtcccctccctccgctccggcggcaggttcgtc
ggcgaccccggcagcgagaagatcgacaagatgctcaacgacctctcccttatcaagaag
ttcgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330570
Entry
4330570           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase II subunit 4 isoform X1
  KO
K03012  DNA-directed RNA polymerase II subunit RPB4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4330570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4330570
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330570
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     4330570
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4330570
SSDB
Motif
Pfam: RNA_pol_Rpb4
Other DBs
NCBI-GeneID: 4330570
NCBI-ProteinID: XP_015627433
UniProt: B7F9H3
LinkDB
Position
2:complement(30053630..30058549)
AA seq 239 aa
MAERGSRGFSAASKGKAIASKKDLPMNVFTGSLRQNSSANIPHVNIDSDSDSEGFVEELP
RVNSKTNGKAASESLKTGGKASSKGQTGKGGNAGKGGKGSASARVSAKSDAELKLELDMP
PNSCILMNCEVAELLQEIHEHMAILSEDPKIKIPESFDKAFQYVKEGNQFSTAQSVKQVL
DPLRKYGVSDGEMCLIANVGPETIEEVYALVPSLKATRSLNESPIMEALTALADIKAAK
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcggagaggggatcgaggggcttctccgcggcctccaaggggaaggccatcgcgtcc
aagaaagatctaccaatgaatgtttttacaggttcacttaggcaaaacagctctgccaat
atcccgcatgttaatattgattccgattctgattctgaaggtttcgtggaagaactgcct
cgtgtcaactctaaaacaaatgggaaggctgcatctgagagcctaaaaactggcgggaag
gcctcatctaaaggacaaactggcaaaggagggaatgctggcaaaggtggaaagggttct
gcatcagctcgagtttctgcaaagtctgatgcagagctaaagcttgagctcgatatgcct
ccaaactcttgcattttaatgaattgtgaagtagcagaactattgcaagaaattcatgag
catatggctatcttatcagaggatccaaagatcaaaattccagagtcatttgataaggct
ttccaatatgtgaaagaaggaaatcagttttccaccgcacagtctgtgaaacaagtccta
gaccctcttagaaaatatggtgttagtgatggagagatgtgcttgatagcgaacgttgga
cctgagaccattgaagaggtttatgcgctagtaccatccctgaaggccactagatcactc
aacgaaagtcccatcatggaggctctcactgcgcttgctgacataaaagctgctaagtga

DBGET integrated database retrieval system