KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328103
Entry
4328103           CDS       T01015                                 
Name
(RefSeq) syntaxin-52
  KO
K08503  syntaxin of plants SYP5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4328103
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4328103
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   STX8
    4328103
SSDB
Motif
Pfam: SNARE DUF2721
Other DBs
NCBI-GeneID: 4328103
NCBI-ProteinID: XP_015626626
UniProt: A3A2I2 Q6YUT2
LinkDB
Position
2:complement(1022181..1024762)
AA seq 232 aa
MASSSDPWVREYSEASRLADDVTSMIADRGSLPQSGPEIMRHTSAIRRKITILGTRLDSL
EALLSRIPPKSITDKELHKRQDMLSNLKSRAKQMATSFNMSNFANREDLLGQSKKAADDM
SRVAGLDNQGIVSLQRQVMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLDDY
VDVTNSRLQRVQKRLAILNKRVKGGCSCMALLISVVAIVFLAVIAWLLIKHL
NT seq 699 nt   +upstreamnt  +downstreamnt
atggcgtcgtcttcggatccatgggtgagggagtacagcgaggcgtccaggctcgcggat
gacgtcacctccatgatcgccgataggggttcgctcccgcagtcggggccggagatcatg
cgccacacctcggccattcggaggaagataaccatcctcgggactaggctcgatagcctc
gaggccttgctgtccaggattcctcccaagtccatcacggacaaggagttgcataagcga
caagacatgctttcaaatctgaaatctagagcaaagcagatggctacaagtttcaacatg
tcaaactttgcaaacagggaggatttgcttggtcagagtaagaaagcagctgatgatatg
agtagagtagctggtttggataaccaaggaatcgtttcacttcagaggcaagttatgaaa
gaacaagatgagggtcttgagaagctggaagagacagtactgagcacaaaacatattgct
ctagcagtcaatgaagaacttaccctgcatacaagattgattgatgatttggatgattat
gttgatgttacaaactcacgtcttcagcgcgtgcaaaagaggcttgctattctgaataag
cgcgtcaaaggtggctgctcgtgcatggccctgctgatatctgtcgttgctatagtgttt
cttgcggtcattgcttggcttctcatcaagcacctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345157
Entry
4345157           CDS       T01015                                 
Name
(RefSeq) syntaxin-52 isoform X1
  KO
K08503  syntaxin of plants SYP5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4345157
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4345157
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   STX8
    4345157
SSDB
Motif
Pfam: SNARE DUF5345 YjcZ DUF2721
Other DBs
NCBI-GeneID: 4345157
NCBI-ProteinID: XP_015650978
UniProt: Q6Z1L9 Q0J6R5
LinkDB
Position
8:10759548..10763615
AA seq 232 aa
MASSSDPWMKEYNEASRLADDINSMIADRGSLPQSGPEIIRHTSAIRRKITILCTRLDSL
EALLSKIPPKSLSDKELHKRQDTLSNLKSKTKQMATSFNMSNFANREDLLGQNKKAADDM
SRVAGLDNQGIVGLQRQIMKEQDEGLEKLEETVLSTKHIALAVNEELTLHTRLIDDLEDH
VDVTNSRLQRVQKRLAILNKRTKGGCSCMCLLLSVVAIVILAVIVWLLIKYM
NT seq 699 nt   +upstreamnt  +downstreamnt
atggcttcatcttcggacccatggatgaaagagtacaatgaggcatctaggcttgctgat
gatatcaattccatgattgccgatagagggtctcttccacaatcaggcccggaaattata
cgtcacacatcagccattcgaagaaaaataactattctttgtactagactggatagcttg
gaagcattgttgtccaagattcctccgaagtcactcagtgacaaggagttacacaagcgc
caagacacgctttccaatttgaaatctaaaacaaaacagatggcaacaagttttaacatg
tcaaactttgccaacagggaggacttgcttggtcagaacaagaaggcagctgatgatatg
agcagagttgctggtttggataaccaagggattgttggccttcagaggcaaattatgaaa
gaacaagatgaaggtcttgagaagctggaagagacagtcctgagtacaaaacatatcgct
ttagcagtcaatgaagaacttaccctgcatacgagattgattgatgacttggaagatcat
gttgatgttacaaactcgcgtcttcagcgtgtgcaaaagaggcttgcaattctgaacaag
cgcaccaaaggtggctgctcatgcatgtgcctgctgctatctgtcgtcgcaatagtgatc
cttgctgttatcgtgtggcttcttatcaagtatatgtaa

DBGET integrated database retrieval system