KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328215
Entry
4328215           CDS       T01015                                 
Name
(RefSeq) proteasome subunit alpha type-1
  KO
K02725  20S proteasome subunit alpha 6 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4328215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4328215
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4328215
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4328215
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4328215
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4328215
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    4328215
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4328215
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 4328215
NCBI-ProteinID: XP_015626959
UniProt: P52428
LinkDB
Position
2:1784552..1788073
AA seq 270 aa
MFRNQYDTDVTTWSPAGRLFQVEYAMEAVKQGSACVGLRSRTHAVLAAANKAASELSSHQ
RKVFRVADHAGVALAGLTADGRVLSRFLRSECINHAFVYDAPLPVSRLALRLADKAQVCT
QRSWKRPYGVGLLVAGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTFLERRFEGYN
DYTPEQLIKDALSAIKETLQGEKLTSSNCTVAIVGRKDDGTVEPFEMIDVKRIQEIIDSM
EAAEEAPAAEAESSSMQEEDKGTDAAPMDI
NT seq 813 nt   +upstreamnt  +downstreamnt
atgttccggaaccagtacgacaccgacgtgacgacgtggagcccggcggggcggctgttc
caggtggagtacgccatggaggccgtgaagcagggctccgcctgcgtcggcctccgctcc
cgcacccacgccgtcctcgccgccgcgaacaaggccgcctccgagctctcctcccaccag
cggaaggtcttccgcgtcgcagaccacgccggggtcgcgctcgccggcctcaccgccgac
ggccgcgtcctctcccgattcctccgctccgagtgcatcaaccacgccttcgtctacgac
gcgcccctccccgtctccaggctcgcgctccgccttgccgacaaggcgcaggtttgcaca
cagcgatcatggaagaggccatatggtgttggcctccttgttgctggattagatgagtct
ggagcccatctatactataactgccccagcggcaactattttgagtaccaggcatttgct
attggctctcgctctcaagccgccaagactttccttgagcgcagattcgagggctacaac
gactacaccccagagcaacttatcaaagatgccctctccgccataaaggagacgctgcaa
ggtgagaagctaaccagctccaactgcaccgttgctattgttggcagaaaggacgatggc
accgttgagccatttgagatgatcgacgtgaagaggatccaagaaataatcgattccatg
gaggctgccgaggaggcaccagcggcagaggctgagtcgagctcgatgcaggaggaggac
aagggcacggacgccgcgcccatggacatctag

DBGET integrated database retrieval system