KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328252
Entry
4328252           CDS       T01015                                 
Name
(RefSeq) glucan endo-1,3-beta-glucosidase 6
  KO
K19893  glucan endo-1,3-beta-glucosidase 5/6 [EC:3.2.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4328252
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
    4328252
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.39  glucan endo-1,3-beta-D-glucosidase
     4328252
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
 Enzymes
  4328252
SSDB
Motif
Pfam: Glyco_hydro_17 X8 GTP_cyclohydro2
Other DBs
NCBI-GeneID: 4328252
NCBI-ProteinID: XP_015627265
UniProt: Q6YXZ6 Q6Z2X7
LinkDB
Position
2:2096208..2100823
AA seq 489 aa
MGSSWWWHGRAAAAVACWVWLAAAAAVGVEAIGANWGTQASHPLAPDTVVQMLKDNGFDK
VKLFDAGEDTMSALRKSGLEVMVGIPNDMLAAMASSMAAANKWVDQNVSNYLNDGVKIRY
VAVGNEPFLETYNGSFLQTTFPAIRNIQSALVKAGLGSQVRVTCPLNADVYQSSTSKPSD
GDFRTDIHDLMLTIVKFLSDTGGAFTVNIYPFISLYSDSNFPVDYAFFDGAASPIVDGSA
TYTNMFDANYDTLIWALKKNGFGNLPVIVGEIGWPTDGDMNANIQMAQHFNQGFLTHIAT
GRGTPMRPGPVDAYLFSLIDEDEKSIQPGNFERHWGIFTYDGLPKYQLNLGQSHGLLKAK
NVKYLERKWCVLKPSIGLTDPRLSDSISYACSLADCTSLGYKTSCGGLDTRSNISYAFNS
YYQKNDQDDVACGFSNLATITGQDPSTGTCRFGIMIEVDSAFSWKLQHVRSSNLLMLLLV
LLQLCLSFS
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgggttcttcttggtggtggcatggaagggcggcggcggcggtggcgtgttgggtgtgg
ctggcggcggcggcggcggtgggggtggaggcgataggggcgaactgggggacgcaggcg
agccacccgctggcgccggacacggtggtgcagatgctcaaggacaacgggttcgacaag
gtgaagctgttcgacgccggggaggacaccatgagcgccctgaggaagagcgggctggag
gtgatggtcggcatccccaacgacatgctcgccgccatggccagcagcatggcggccgcc
aacaagtgggtcgaccagaacgtctccaactacctcaacgacggcgtcaagatcaggtat
gttgctgttggtaacgagcctttcctggagacatacaatggaagctttctgcaaactact
tttcctgccatcagaaacatacaaagtgcgcttgtgaaggctggcttgggtagtcaagtt
agagtgacatgccctctcaatgctgatgtttatcaatcatcgactagcaagccttctgat
ggggacttccgcacagatattcatgatctgatgctcaccatcgtaaaattcctgagcgat
actggtggagctttcactgtcaacatctaccctttcataagcctctattctgattcaaac
ttccctgtcgactacgccttctttgatggtgccgcatcacccattgttgatggctctgcg
acatacacaaacatgtttgatgcaaactatgacacacttatatgggctttgaagaagaat
ggctttggaaatctcccagtcattgttggggagattggatggccaactgacggggacatg
aatgcaaatattcagatggcgcagcacttcaaccaaggcttcctaacacatattgccaca
gggcgaggaacgccgatgaggcctggaccagttgatgcttacttgttcagtctaatcgat
gaggatgagaagagcatacagccaggtaattttgagcgtcactgggggatattcacctat
gatggcttgccaaagtatcaactgaatcttgggcaatcacatggccttctcaaagcgaag
aacgtgaagtaccttgagaggaagtggtgcgtgctgaagccttctataggccttactgat
ccaaggctttcagatagcatcagctatgcctgctccctggcagattgcaccagccttggt
tacaagacatcttgtgggggactggacaccagaagcaacatctcgtacgcgttcaacagc
tactaccagaagaacgatcaagacgatgtcgcctgtgggttctcgaacctcgcaacgatc
actggccaagaccccagcaccggaacatgcagattcggtatcatgatcgaggttgactcg
gccttctcgtggaagctgcagcatgttagaagcagcaacctcttgatgcttctgctagtg
cttctccagctttgcctgtcattctcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332097
Entry
4332097           CDS       T01015                                 
Name
(RefSeq) glucan endo-1,3-beta-glucosidase 3 isoform X1
  KO
K19891  glucan endo-1,3-beta-glucosidase 1/2/3 [EC:3.2.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4332097
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
    4332097
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.39  glucan endo-1,3-beta-D-glucosidase
     4332097
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
 Enzymes
  4332097
SSDB
Motif
Pfam: Glyco_hydro_17 X8
Other DBs
NCBI-GeneID: 4332097
NCBI-ProteinID: XP_015628658
UniProt: A3AFL0 Q8H822
LinkDB
Position
3:6369444..6373697
AA seq 504 aa
MKKLFFFLFLLILAASVVHGEDGAYIGVNIGTAMTSVPAPTQITTLLRSQNIRHVRLYDA
DPAMLAALANTGIRVIVSVPNEQLLAIGNSNATAANWVARNVAAHYPSVNITAIAVGSEV
LSTLPNAAPLLMPAIRYLQNALVAAALDRYIKISTPHSSSIILDSFPPSQAFFNRSLDPV
LVPLLKFLQSTGSPLMLNVYPYYDYMRSNGVIPLDYALFRPLPPNKEAVDANTLLHYTNV
FDAVVDAAYFAMAYLNVTNVPVMVTETGWPHKGDPSNEPDATSDNADTYNSNLIRHVMNT
TGTPKHPGVAVPTYIYELYDEDTRPGSTSEKYWGLFDMNGIPAYTLHLTGSGVLLANDTT
NQTYCVAREGADEKMLQAALDWACGPGKVDCSALMQGQPCYDPDNVEAHATYAFNAYYHG
MGMGSGTCYFSGVAVITTTDPSHGSCVYAGSGGKNGTSLLNGTSLAPSSNSTAGDSGAHR
AIGDVSSFVRAVVAALLLSVVLLL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgaagaagctcttcttcttcctcttcctgctgatactggccgcctcggttgttcacggc
gaggacggggcgtacatcggcgtcaacattggcacggccatgacgtcggtaccggcgccg
acacagatcacgacgctgctccgctcgcagaacatccgccacgtgcggctgtacgacgcc
gacccggcgatgctcgcggcgctcgccaacaccggcatccgcgtcatcgtctccgtgccg
aacgagcagctcctcgccatcggcaactccaacgccacggcggccaactgggtggcgcgc
aacgtggccgcgcactacccttccgtgaacatcacggccatcgcggtcggctccgaggtg
ctctccacgctgcccaacgcggcgccgctcctcatgccggccatccgctacctccagaac
gcgctggtggccgcggcgctcgaccggtacatcaagatctcgacgccgcactcctcgtcc
atcatcctcgactcgttcccgccgtcgcaggccttcttcaaccgctccctggacccggtg
ctggtgccgctgctcaagttcttgcagtccacgggctcgccgctgatgctcaacgtgtac
ccgtactacgactacatgcgctccaacggcgtcatcccgctggactacgcgctgttccgg
ccgctgccgccgaacaaggaggcggtggacgccaacaccctgctgcactacaccaacgtg
ttcgacgcggtcgtggacgctgcctacttcgccatggcgtacctcaacgtcaccaacgtg
ccggtgatggtgacggagaccgggtggccgcacaagggcgacccgtccaacgagcccgac
gccacctccgacaacgccgacacctacaacagtaacctcatccggcacgtgatgaacacc
accggcacgccgaagcaccccggcgtcgccgtgccgacgtacatctacgagctctacgac
gaggacacccgccccggctcgacgtcggagaagtactggggcctgttcgacatgaacggc
atcccggcgtacaccctgcacctgacaggctccggcgtgctgctcgccaacgacacgacg
aaccagacctactgcgtggcgcgggagggcgctgacgagaagatgctgcaggcggcgctc
gactgggcttgcggcccgggcaaggtggactgctccgcgctgatgcaggggcagccgtgc
tacgacccggacaacgtcgaggcgcacgccacctacgccttcaacgcctactaccatggc
atgggcatgggctccgggacgtgctacttcagcggtgtcgccgtgatcaccaccaccgat
cccagccacgggtcttgcgtttacgctggaagtggtgggaagaacgggacgtcgttgctg
aacggcacatcgctggcgccgtcgtcgaactccacggcgggggactccggcgcgcaccgg
gcgatcggggacgtctcgtcgttcgtccgcgccgtcgtcgcggcgctgctgttgagcgtc
gtcctcctgttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332950
Entry
4332950           CDS       T01015                                 
Name
(RefSeq) glucan endo-1,3-beta-glucosidase 1
  KO
K19892  glucan endo-1,3-beta-glucosidase 4 [EC:3.2.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4332950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
    4332950
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.39  glucan endo-1,3-beta-D-glucosidase
     4332950
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
 Enzymes
  4332950
SSDB
Motif
Pfam: Glyco_hydro_17 X8
Other DBs
NCBI-GeneID: 4332950
NCBI-ProteinID: XP_015632980
UniProt: Q7Y157 Q0DRL0
LinkDB
Position
3:14759746..14767834
AA seq 478 aa
MMLDRRWRGTILLLICLVCNASGTYVGANTIPSPENSPSEFAKIVQSKQTKHARVFIGGG
DHRSLRSLANTGEEVILTVPNDQLEHMAEFPEEAELWVAANVARFLPATRITHVVAGDDV
VARSPGNAYFLLPAMANLHAALAASRLDGRVKVSSAVSGAALQAPPAWAAAAVAGGLLRF
LNATGAPLFLKTRPSESTDTMVDAAYGAMRALGFPGGAIPVIAAPVETEEFGGGATTVVY
HSYLLQASGGVGGGERRSLATSAGMFCVALQNADAAALQAGLNWACGPGQADCAAIQPGG
ACYKQNNLPALASYAYNDYYQKMASTGATCSFNGTATTTTADPSSGSCVFTGSSMAGGSN
TSVPGASPPTTLSPPAGLTPPVGTSPPTDFSPPAAGTTPPAGGFTPPAGGFGTPPLGGFG
TPPSGFGPPGSFNGSGSSFGPSSAFSPYGGAGHRDGGASGARLAAAALAVLLLSVDLM
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgatgttggacagaagatggcggggaaccatacttttgctcatctgtcttgtctgcaat
gcatcagggacttatgttggcgccaacacgatcccttcgccggagaactcgccgtcggag
ttcgccaagattgttcagtctaagcagacgaagcatgcgcgcgtgttcatcggcggcggg
gaccatcggtcgctgcgatcgctggcgaacaccggcgaggaggtgatcctcaccgtgccc
aacgaccagctcgagcacatggccgagttcccggaggaggccgagctctgggtcgccgcc
aacgtcgcgcggttcctcccggcgacgaggatcacgcacgtggtggccggcgacgacgtt
gtggccaggtcaccggggaacgcgtacttcctcctcccggcgatggccaacctccacgcc
gcgctcgccgcgtcgcgcctcgacggccgcgtgaaggtgtcgagcgcggtgtccggcgcc
gcgctgcaggctcccccggcgtgggccgccgccgccgtggcgggcggcctcctccggttc
ctgaacgccaccggcgcgccgctgttcctcaagacccggccgtcggagtccacggacacc
atggtcgacgcggcctacggcgcgatgcgcgcgctggggttccccgggggcgccatcccg
gtgatcgcggcgccggtggagacagaagaattcggcggtggcgcgacgacggtggtgtac
cacagctacctgctgcaggcctccggcggcgtcggcggcggcgagaggcggtcgctggcg
acgtcggcggggatgttctgcgtggcgctgcagaacgcggacgcggcggcgctgcaggcg
gggctgaactgggcgtgcgggcccgggcaggcggactgcgcggcgatccagcccggcggc
gcgtgctacaagcagaacaacctgccggcgctggcgtcctacgcctacaacgactactac
cagaagatggcgtccaccggcgccacctgctccttcaatggcaccgccaccaccaccacc
gccgatcccagctcaggatcatgcgtcttcacaggaagctcgatggcaggaggctcgaac
acgagcgtgccgggagccagccctccgacgacgctctccccaccggcgggcctcacgccg
ccggtcggcaccagcccaccgaccgacttcagcccgccggcggccggcacgacccctccg
gccggcggcttcaccccgccggcgggcggcttcggcaccccgccgctgggcgggttcggc
acgccgccgtcggggttcggcccgccggggagcttcaacgggagcggctcgtcgttcggg
cccagcagcgccttcagcccgtacggcggcgccggccaccgcgacggcggcgcctccggc
gctcgcctcgccgccgctgccctcgccgtgctgctcctgtccgtcgatctcatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343350
Entry
4343350           CDS       T01015                                 
Name
(RefSeq) glucan endo-1,3-beta-glucosidase 1
  KO
K19891  glucan endo-1,3-beta-glucosidase 1/2/3 [EC:3.2.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4343350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
    4343350
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.39  glucan endo-1,3-beta-D-glucosidase
     4343350
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
 Enzymes
  4343350
SSDB
Motif
Pfam: Glyco_hydro_17 X8 DUF5900
Other DBs
NCBI-GeneID: 4343350
NCBI-ProteinID: XP_015647992
UniProt: A0A0P0X6V9 Q6Z4B3
LinkDB
Position
7:19436911..19442954
AA seq 540 aa
MGSRSRGGRHLLLLLLLHLLSLHSSLLPWAAVSAAGGGGSGDPYVGVTIGTAVTNLLSPS
DLPEFLRAQRITHVRLYDADPRMLSALASSGARAIVGVPNDELLALGSSPATASAWVARR
VLPYAGANSSTPGLIAAIAVGDEVPTALPSALPVLLPAIQSLAAALAAANLSSIPVSTPL
PFSVVLDPFPPSQAFFNQSLAKSFILPLLSHLANTSAPLMLNLYPYYSMMQSNGVIPLDN
ALFKPLPPSLEMVDPNTLLHYTNVFDAMLDAVHVAVKNLNATGGGGPVPVLVTETGWPSY
GDRRAEPYATRDNADAYNSNLIKHVNDKPGTPMRPGAQASVYIYELFNEDLRPGPVSEAN
WGLFHGNGTPVYLLHVSGAGGFLANDTTDRTFCIASDDADEKAVQAAMDWACGPGRTDCT
AIQPGQGCYEPNDVRSHASFAFDSYYQSQGKAAGSCYFQGVGMVTTTDPSHDSCIFPGSK
LLSNVTKSDGANTTTAQTSDAEGSAIWRLRTGRETGFLFILRWLLSLSVVLITTNSNFWT
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggggagtaggagcagaggagggagacacctcctcctcctcctcctgcttcacctcctc
tccctccattcctctctgctaccatgggcggcggtgtcggcggcgggagggggtggttcc
ggagacccgtacgtcggcgtgacgatcgggacggcggtgacgaacctgctgtcgccgtcg
gacctccccgagttcctccgcgcgcagcgcatcacccacgtgcgcctctacgacgccgac
ccgcgcatgctgtcggcgctagcgtcgtcgggcgcccgcgccatcgtcggcgtccccaac
gacgagctcctcgcgctgggctcctccccggccaccgcctccgcctgggtcgcccgccgc
gtgctcccctacgccggcgccaactccagcaccccggggctcatcgccgccatcgccgtc
ggcgacgaggtccccaccgcgctcccctccgcgctccccgtgctcctcccggccatccag
tccctcgctgccgcgctcgccgccgccaacctctcctccatcccggtctccacaccgctc
cccttctccgtcgtcctcgacccgttcccaccctcccaggccttcttcaaccagtcgctg
gccaagtcgttcattctcccgctcctctcccacctcgccaacacctcggcgccgctcatg
ctcaacctctacccgtactactccatgatgcagagcaacggcgtgatcccgctcgacaac
gcgctgttcaagccgctcccgccgtcgctggagatggtcgaccccaacacgctgctccac
tacaccaacgtgttcgacgcgatgctcgacgcggtgcacgtcgccgtgaagaacctcaac
gcgaccggcggcggcgggccggtgccggtgctggtcacggagaccgggtggccgtcgtac
ggggaccgcagggcggagccgtacgccacgcgggacaacgccgacgcctacaactccaac
ctcatcaagcacgtcaacgacaagcccggcacgccgatgcgccccggcgcgcaggccagc
gtctacatctacgagctcttcaacgaggacctccgcccgggcccggtctcggaggcgaac
tggggactcttccacggcaacggcacgccggtgtacctgctccacgtgtccggcgccggc
ggcttcctggccaacgacacgacggaccggacgttctgcatcgcgtccgacgacgccgac
gagaaggcggtgcaggcggccatggactgggcgtgcggccccgggcgcaccgactgcacg
gcgatccagccagggcaaggctgctacgagcccaacgatgtgcggagccacgcctccttc
gcattcgacagctactaccagtcgcagggcaaggccgctggctcctgctacttccagggc
gtcggcatggtcaccaccactgatcccagtcacgatagctgcatctttccaggaagcaag
ctgttgagcaacgtcaccaaatctgacggggcaaacacaaccactgcgcagacgagtgat
gcagagggctctgcaatatggaggctaagaactggaagggagacagggttcttgttcatc
ctccggtggttgttgagcttgtcagtggtgcttatcacgacgaattcaaacttttggaca
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343706
Entry
4343706           CDS       T01015                                 
Name
(RefSeq) glucan endo-1,3-beta-glucosidase 4
  KO
K19892  glucan endo-1,3-beta-glucosidase 4 [EC:3.2.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4343706
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
    4343706
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.39  glucan endo-1,3-beta-D-glucosidase
     4343706
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
 Enzymes
  4343706
SSDB
Motif
Pfam: Glyco_hydro_17 X8
Other DBs
NCBI-GeneID: 4343706
NCBI-ProteinID: XP_015647153
UniProt: Q0D572 A0A0P0X844
LinkDB
Position
7:23343639..23348726
AA seq 498 aa
MLEHRNMWPASLKGVVILLMLMVFNVSGAFVGINVGTDISNPPSASDTVSILKEKKIQHV
RLLDSDHQMLSALANTGIEVVVGVPNDQLLRVGQSRSTAADWINKNVAAYIPATNITHIA
VGNEVLTTEPNAALVLVPALQFLQSALLAANLNTQVKISSPHSTDMISKPFPPSTATFNS
TWSSIMLQYLQFLNNTASPFMLNAQPYYDYVKGQGVFPLEYALFRSLNPDSQISDPNTNL
FYTNMFDAMVDATYNSMQAMNFTGIPVMVTASGWPSHGGQNEKAANVDNALAYNTNLIRH
VLNNSGTPGQPNNQVSTFIFELFNEDLRAGPVSEKNWGIMFPNATTVYSLTFEDMATTNT
DSPVLRGTFCVANSSAPHSALKQSLDWACGPGSANCSAIQPGQPCYKSDDIVAVASYAFN
DYYHRTRASGGTCNFNSTAMVTSTDPSHGSCIFAGSTGSNGSNGGAASGPVSPDNFATQI
HSCWLTHLITLLSIMVFM
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgctagagcaccgaaatatgtggccagcgagcctaaaaggcgtggtgattctgttaatg
ctcatggttttcaatgtttcaggagcatttgttggtatcaatgttggcactgatatttcg
aacccaccatcagcatcagacacagtgtctatcctgaaagaaaagaagattcaacatgtt
cgtctgcttgattcagaccatcagatgctatctgcccttgcaaatactggaatagaagtg
gtggttggggttccaaatgatcagctacttcgagtggggcaatctcgttctacagctgct
gattggattaacaagaatgttgctgcatacattccagcgactaacataacgcatattgct
gtagggaatgaggttcttactacagaaccaaatgcagctcttgttcttgtacctgcattg
caattcctacagtcagcgcttttggctgcaaatctcaatacccaggtgaaaatttcaagt
cctcattcaacagacatgatctctaagccatttcctccatctactgctacattcaattcg
acatggagctcaataatgcttcagtatcttcaatttctgaacaacacagcatctcccttc
atgctgaacgcccaaccttattatgactatgtcaaagggcaaggcgtattccccttagaa
tatgcgctgtttcgatcactcaaccctgatagccaaatttcagatcccaacacaaatttg
ttctataccaatatgtttgatgctatggttgatgctacatacaactcaatgcaagcaatg
aatttcactgggatccctgttatggtcacagcttctgggtggccatcgcatggtgggcaa
aatgagaaggctgctaatgtggataatgctttggcctacaatacaaacctcatacgccat
gtattaaataattctggtactcctggccagccaaacaatcaagtaagcacattcatattt
gagttgttcaatgaggatcttcgggctggacctgtctcagagaaaaattggggcatcatg
ttccccaatgcaactactgtgtacagccttacatttgaagacatggccacaactaataca
gattcaccagttttgcgagggacattctgtgtagcaaattctagtgctcctcatagcgca
ttgaagcaaagcttggattgggcctgtggccctggctctgcaaactgcagtgcaattcaa
cctgggcaaccatgctataaatcagatgacattgtcgctgttgcttcttatgctttcaat
gattattaccataggacacgagcaagtggcggaacatgcaacttcaatagcacggcaatg
gtgacatctactgatccaagccatggttcatgcatttttgcaggaagcactggctccaat
ggcagcaacggtggtgcggcgtctgggcccgtaagcccagacaattttgctacacaaatt
cactcgtgctggttgactcacctaattacattgctgtctatcatggtgttcatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344970
Entry
4344970           CDS       T01015                                 
Name
(RefSeq) glucan endo-1,3-beta-glucosidase 6
  KO
K19893  glucan endo-1,3-beta-glucosidase 5/6 [EC:3.2.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4344970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
    4344970
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.39  glucan endo-1,3-beta-D-glucosidase
     4344970
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:osa00537]
 Enzymes
  4344970
SSDB
Motif
Pfam: Glyco_hydro_17 X8
Other DBs
NCBI-GeneID: 4344970
NCBI-ProteinID: XP_015648641
UniProt: Q84QM8 Q6Z923
LinkDB
Position
8:7583195..7588460
AA seq 494 aa
MAPAPLAGGRLVLVVVVAAACMARWSEGIGVNWGTQLSHPLPASTVVQLLKDNGFDRVKL
FDAEDGILAALKGSGIQVMVGIPNDMLADLAAGAKAADDWVATNVSNHVNNGVDIRYVAV
GNEPFLETFNGTYLNTTFPAMQSVQAALKKAGLADKVKVTVPLNADVYQSPTGKPSDGDF
RADIHGLMLTIVQFLADTGAPFVANVYPFISLYKDPNFPLDYAFFQGSSAPVVDGGVTYQ
NTFDANHDTLVAALRRNGYPNVSIIVGEVGWPTDGDANANPQYARQFNQGFLTHIASGQG
TPLRPGPVDAYLFSLIDEDQKSIEPGNFERHWGVFYYDGQPKYPLSLRGGGNGNGNGSTL
MPAKGVTYLQRRWCVMKPSASLVDQKVGDGVSYACGLADCTSLGYKTSCGGLDAKGNVSY
AFNSYYQVNDQDDRACDFKGIATTTTVDPSAGSCRFIIEIAPTANGVAMAATVRVAGVMA
AILAVFIHLVVPVF
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggcgccggcgccgctcgccggcggcaggctggtgctggtggtggtggtggcggcggcg
tgcatggcgcggtggtcggaggggatcggcgtgaactggggcacgcagctgagccacccg
ctgccggcgagcacggtggtgcagctgctcaaggacaacgggttcgacagggtgaagctg
ttcgacgccgaggacggcatcctggcggcgctcaaggggtcgggcatacaggtgatggtc
ggcatccccaacgacatgctcgccgacctcgccgccggcgccaaggccgccgacgactgg
gtcgccacgaacgtctccaaccacgtcaacaacggcgtcgacatcaggtacgtagccgtc
gggaacgagccgttcctggagacgttcaacgggacgtacctgaacacgacgttcccggcg
atgcagagcgtgcaggcagcgctgaagaaggccgggctcgccgacaaggtgaaggtgacg
gtgccgctcaacgccgacgtgtaccagtcgccgacggggaagccctccgacggcgacttc
cgcgccgacatccacggcctgatgctcaccatcgtccagttcctcgccgacaccggcgcg
ccgttcgtcgccaacgtgtacccgttcatcagcctctacaaggaccccaacttcccgctc
gactacgccttctttcagggctcgtcggcgccggtggtggatggtggcgtgacgtaccag
aacacgttcgacgccaaccacgacacgctggtggcggcgctgcggcggaacgggtacccg
aacgtgtccatcatcgtcggcgaggtcgggtggccgaccgacggcgacgccaacgcgaac
ccgcagtacgcacgacagttcaaccaggggttcctcacccacatcgcctccggccagggc
acgccactccggcctggccccgtcgacgcctacctcttcagcctcatcgacgaggaccag
aagagcatcgagccgggcaacttcgagcgccactggggcgtcttctactacgacggccag
cccaagtaccctctcagccttcgcggcggcggcaacggcaatggcaatggcagcacgctg
atgccggcgaagggtgtgacctacctgcagcggcggtggtgcgtgatgaagccgtcggcg
agcctcgtcgaccagaaggtcggcgacggcgtgagctacgcgtgcgggctcgccgactgc
acaagcctcgggtacaagacgtcgtgcggcggcctcgacgccaaggggaacgtgtcgtac
gcgttcaacagctactaccaggtgaacgaccaggacgaccgtgcctgcgacttcaagggc
atcgccaccaccaccactgtcgacccctctgccgggtcatgccgcttcatcatcgagatt
gcgcccaccgccaacggcgtcgccatggcggcaacagttagggtcgccggcgtcatggct
gccatcctcgccgtgttcatacacttggtggtgcccgtgttctga

DBGET integrated database retrieval system