KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328266
Entry
4328266           CDS       T01015                                 
Name
(RefSeq) L-arabinokinase
  KO
K12446  L-arabinokinase [EC:2.7.1.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4328266
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.46  L-arabinokinase
     4328266
SSDB
Motif
Pfam: GHMP_kinases_N GalKase_gal_bdg Glyco_trans_1_3 GHMP_kinases_C Glyco_transf_4 Glyco_trans_4_4 Glyco_tran_28_C
Other DBs
NCBI-GeneID: 4328266
NCBI-ProteinID: XP_015626786
UniProt: B9F2N4 Q6YX79
LinkDB
Position
2:complement(2230734..2239520)
AA seq 996 aa
MRIRGDGGGDEEEAAMAVVSAPPQHLVFAYYITGHGFGHATRALEVVRHLIAAGHDVHVV
TGAPEFVFTTEISSPNLHIRKVLLDCGAVQADALTVDRLASLEKYHQTAVMPRESILRTE
VEWLNTIKADLVVSDVVPVACRAAADAGIRSVCVTNFSWDFIYAEYVVVAGHHHRSIVWQ
IAEDYSHCEFLLRLPGYCPMPAFRDVIDVPLVVRRLHKSRSEVRKELGIKDDVKVVIFNF
GGQPAGWKLKKEWLPDGWLCLVCGASETQELPPNFIKLAKDAYTPDLMAASDCMLGKIGY
GTVSEALAYKLPFVFVRRDYFNEEPFLRNMLEHYQCGVEMVRRDLLTGHWKPYLQRAMTL
HPCYDGPINGGEVAAHILQDTAVGKKYISGKLSGARRLRDAIVLGYQLQRAPGRDVGIPD
WYSVSEKEIGVRPAPTYHEVNGSAESSFEDFEILHGDIQGLTDTMAFLTSLSGLVGNDPR
SPEKQSRERVAASVFFDWEEEIYVARAPGRLDVMGGIADYSGSLVLQMPIREACHVAIQR
SNPMKQKLWKHTQARQLANGRAVPLLQIVSFGSELSNRAPTFDMDLSDFMDGDKPISYDK
AKEYFSQDPSQKWAAYVAGTILVLMTELGVVFTDSMSILVSSSVPEGKGVSSSASVEVAS
MSAIAAAYGLNIPPRDLAILCQKVENRIVGAPCGVMDQMTSACGEANKLLAMICQPAEVK
ELVSIPTHIRFWGLDSGIRHSVGGTDYGSVRVGTYMGRKMIKCAASDLLSESLPSCPPIQ
SGNTNSDEYEEHGVDLLKSEASLEYLCNLPPHRYEAVYARDIPEIITGDAFLEKYGDHND
AVTTVDPKRSYCVKAPTRHPIYENFRVEAFKALLTAAKTVEQLSALGELMYQCHYSYNAC
GLGSDGTDRLVNMVQEVQHRKTSQDGGPSLFGAKITGGGSGGSVCVIGKNCLKSSEEIFE
IQKRYKAATGYLPIVFEGSSPGAGKFGYLKIRRRST
NT seq 2991 nt   +upstreamnt  +downstreamnt
atgaggattcggggagacggcggaggtgatgaggaggaggcggcgatggcggtggtgtcg
gcgccgccgcagcatctggtcttcgcgtactacatcaccggccatggcttcggccacgcc
acccgcgcgctcgaggtggtgaggcacctgatcgcggcggggcacgacgtgcacgtggtc
accggcgcgccggagttcgtcttcaccaccgagatcagctcgcccaacctccacatccgc
aaggtgctcctcgactgcggcgccgtccaggccgacgccctcaccgtcgatcgcctcgcc
tccctcgagaagtatcatcagacggccgtgatgccacgcgaatcgattctgaggactgag
gtggaatggctcaacacgatcaaggccgacctagtggtttcagatgtcgtccccgtcgcg
tgcagggcggctgcggatgctggcattcgatcggtgtgcgtcaccaatttcagctgggac
ttcatttatgcagagtatgtcgtagtagctggacatcatcatcgctcaattgtgtggcag
atagcagaagattattcacattgtgaattcttactacgactccctggatactgccctatg
cctgctttccgtgatgtcattgatgttcctcttgtggtgagaagattgcataaatctaga
tctgaggtgaggaaggaattaggaattaaagatgatgttaaggtggtcattttcaacttt
ggaggacagcctgcaggatggaaactgaagaaagaatggctgcctgatggttggctctgt
ttggtatgtggtgcatctgaaactcaagagcttccaccaaatttcattaaacttgcaaag
gacgcctatacacctgatttgatggcagcatctgactgcatgcttgggaaaattggatat
ggcactgtgagtgaggctttggcttacaagctgccatttgtatttgttcgtagagattat
ttcaatgaagagccgtttttgaggaatatgcttgagcattatcaatgtggcgttgagatg
gtacggagggatttacttactggacactggaaaccttatctgcaacgtgctatgacactt
catccatgctatgatggtccaataaatggtggtgaggtggctgcacatatcctccaggac
actgctgttggcaagaagtatatttctggcaagttgagcggagcaagacgtttgcgtgat
gccatagtgctaggatatcaactacaaagggctccagggagagatgtcggaattcctgac
tggtattctgtgtctgagaaagaaatcggtgttcgtccagcaccaacatatcatgaggtt
aatggaagtgcagagtcatcttttgaggacttcgagatactccatggggacatacaagga
ttaactgatacaatggcatttttaactagtttatcaggacttgttggaaatgatccaagg
agccctgagaagcaatctcgagagagggttgctgcttctgttttctttgattgggaggag
gaaatatatgttgcaagagcacctggacgtttagatgtcatgggtggcatcgcagattat
tcaggaagtcttgtattacagatgcccattcgagaggcttgtcatgttgctattcagaga
agtaatcctatgaagcagaagctatggaagcatacacaagctaggcaactagcaaatggc
agagcagtgccgttgttacaaattgtatcatttggttctgaattgagtaatcgtgcacca
acctttgatatggacctgtctgattttatggatggtgacaaaccaatatcctatgataag
gccaaagaatatttctctcaggacccatcccaaaaatgggctgcatatgttgctggaaca
atccttgtgttgatgaccgagctaggtgtggtcttcacagacagcatgagcattctggtt
tcttcatcagttcctgaaggtaaaggtgtctcctcttctgcatcagtggaggttgccagt
atgtctgctattgctgctgcctatggtctaaatatccctccacgggatcttgccatactc
tgccaaaaggttgagaatcgcattgttggagcaccttgtggtgtaatggatcaaatgaca
tctgcttgtggagaagctaacaaacttcttgcaatgatttgtcagcctgcagaagtgaaa
gagttggtcagcattccaactcacattcgattttggggtcttgactctgggatacgacat
agtgttggtgggactgattatggctctgtaagggtaggcacttacatgggacgcaagatg
atcaagtgtgctgcatctgatcttctttcagaatcattaccctcctgtcctcctattcaa
tcaggcaacacaaattctgatgaatacgaagaacatggtgtagatcttttgaaatctgaa
gcgtcgctggagtatttatgcaacctaccacctcatagatatgaagctgtttacgcgaga
gatattccagagatcataaccggggatgcatttttggagaagtatggagatcataatgat
gcagtaacaactgttgacccaaaacgatcttactgtgtgaaggctcctactagacatcct
atatacgagaacttccgagttgaggccttcaaagcattgctaacagcagccaaaacagtt
gagcaactttcggcccttggagaattgatgtatcagtgccactacagctacaatgcttgt
gggcttggttctgatggaaccgacaggcttgttaatatggtacaagaagtccagcacagg
aagacctcacaggatggtggtcctagtttatttggtgcaaagataactggtggaggatct
gggggctcggtttgtgtcattgggaaaaattgcttgaaaagcagtgaagagatttttgag
attcagaagagatacaaagctgctaccgggtacctaccaattgttttcgagggctcatct
ccaggtgcaggcaagtttggatacctgaagattcgacggcgatccacatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341977
Entry
4341977           CDS       T01015                                 
Name
(RefSeq) L-arabinokinase isoform X1
  KO
K12446  L-arabinokinase [EC:2.7.1.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4341977
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.46  L-arabinokinase
     4341977
SSDB
Motif
Pfam: GHMP_kinases_N GalKase_gal_bdg Glyco_trans_1_3 GHMP_kinases_C Glyco_transf_4 Glyco_trans_4_4 Glyco_tran_28_C
Other DBs
NCBI-GeneID: 4341977
NCBI-ProteinID: XP_015643923
LinkDB
Position
6:29626030..29634251
AA seq 1000 aa
MPPAGDAAHAPPPPHRRLVFAFYLTGHGFGHATRAIEVVRHLIAAGHEVHVATAVPEFVF
TAELPRSPSSQGLLHIRRAILDCGAVQTDALTVDPLASLLKYHETAVVPRESILRTEAEW
LTSINADLVISDVVPVACRVAADVGIPSVCIGNFSWDYIYAEYIVASGDHHRSIVWQIAE
DYSHCDILLRLPGYCPIFLKSIVPAFRDVTDVPLVVRGLRKSRSEVRKELGIAENAKVVV
FNFGGQPAGWNLKQEWLPDGWICLVCGASDSQEVPPNFIKLAKDAYTPDAMAASDCMLGK
IGYGTASEALAYKLPFIFVRRDYFNEEPFLRNLLEHYQSSIEMTRRDFLHGHWKPYLLRA
LTLQPCYDGPTNGGEVAARILEDTAVGKKCISDKFNGARRLQDAIVLGYQLQRAPGRDVA
IPDWYSLSETEVGACPISENIKTKESTESCFEDFEILHGDLQGLPDTMSFLKSLSEFNQS
ELKSNGKQPQERIAASVLFDWEEEMYIARAPGRLDVMGGIGDYSGSLVLQLPLREACHVA
VQRNHPSNQKLWENTQARRLENGGMEPVVQIVSFGSELSNRSPTFDMKLSDLMDVDKPIS
YEKAREFFCRNPSQKWAAYVAGTILVLMTELDVKFTDSMSILVSSDVPEGKGVSSSASVE
VATMAAIAAAYGLNIAPRDLALLCQKVENHVVGAPCGVMDQMTSACGEANKLLAMVCQPA
EVKELVAIPNHMRFWGLDSGIRHSVGGGDYGSVRVGTYMGRKMIKCAASDLASESSVSDA
PVQSNDYKQNAIELLKSEASLEYLCNIPPHRYEAIYAKDIPEVITGDAFLKKYGDHDDTV
TAIDPKRSYNVKAPTRHPIYENFRVETFKALLEAANTDEQLSALGELMYQCHYSYNACGL
GSDGTDLLVNLVQEMQHRNMSKGESPSLFGAKITGGGSGGSVCVMGKNCLKSSEEIIEIQ
QRYKAATGYLPILFDGSSPGAAKFGYLKIRRRPSSPIAAK
NT seq 3003 nt   +upstreamnt  +downstreamnt
atgccacccgccggagacgccgcccacgcgccgccgccgccgcaccgccgcctcgtcttc
gccttctacctcaccggccacggcttcggccacgccacccgcgccatcgaggtggtgcgg
cacctgatcgcggcggggcacgaggtgcacgtggccacggcggtgccggagttcgtcttc
accgccgagctgccgcgctccccgtcctcccagggcctcctccacatccgcagggccatc
ctcgactgcggcgccgtccagaccgacgccctcaccgtcgaccccctcgcctccctcctc
aagtatcatgagacggccgtggtgccccgcgagtcgattttgaggaccgaggcggagtgg
ctcacctccatcaacgcagacctagtgatctcggatgttgttcctgtggcctgcagggtg
gctgcagatgttggtatcccctcggtctgcattgggaattttagttgggactacatatat
gcagaatatattgtggcatctggcgatcatcaccgttctattgtttggcagatagcggag
gattattctcattgtgatatcttacttcgactacctggatactgccctattttccttaaa
tccatagtgccggctttccgtgatgtcactgatgtgcctcttgtggtaagagggctacgc
aaatctagatcagaggtgaggaaggaacttggaatagcagaaaatgcgaaggtggtggtt
tttaattttgggggacagccagcaggatggaacctgaagcaagaatggctgcctgatggc
tggatctgtttggtctgcggtgcatctgattctcaagaggttcctccaaacttcattaag
cttgcaaaagatgcttacacacctgatgctatggcagcatctgactgcatgcttgggaaa
attggatatggaactgcaagtgaggctttggcctacaagctgccatttatctttgtccgc
agagattattttaatgaagagccatttttgcggaatttacttgagcactaccagagcagt
attgaaatgaccagaagggacttccttcatgggcactggaaaccttatctactccgtgct
ctcacacttcaaccatgctatgatggtccaacaaatggtggtgaggtggctgcacgaatc
ctcgaggacactgctgttgggaagaagtgtatttctgacaaattcaatggagcaagacga
ttgcaagacgccatagtgttagggtatcaattacaaagggctccagggagagatgtagcg
attcctgactggtattctctttccgagacagaagttggtgcctgtccaatctcagaaaat
attaaaacaaaagaaagcaccgaatcatgttttgaagactttgagatacttcatggggat
ctgcaaggattaccagacaccatgtcctttttgaagagcttatctgaatttaatcaaagt
gagttaaagagtaatgggaagcaacctcaagagagaattgctgcatctgtgctctttgac
tgggaggaggaaatgtatatagcaagggcacctggtcgtttagatgtcatgggtggcatt
ggtgactattcaggaagtctagtcttgcagctgccccttcgggaagcctgtcatgttgct
gtacagaggaaccacccaagcaatcagaagctatgggaaaatacacaggcaagacggctt
gagaacggaggcatggaacctgtggtacaaatagtatcatttgggtctgaattgagtaac
cgttcaccaacttttgatatgaaattgtcagatttaatggatgtcgacaaaccaatatcc
tacgagaaagccagagaatttttttgtcgcaacccatcccagaaatgggctgcttatgtc
gctggaacaattctagtgttgatgactgagctagatgtgaagttcactgacagcatgagc
attctggtttcgtctgatgtgccagaaggcaaaggtgtttcttcttctgcatcagtggag
gttgcaactatggctgctattgcagctgcctatggtctaaacattgctccaagggacctc
gctttgctttgtcagaaggttgagaatcatgttgtcggagctccatgtggagtaatggac
caaatgacatctgcttgtggagaagctaacaaactccttgcgatggtttgccagcctgca
gaagtgaaggaattggttgccattcctaatcatatgcggttttggggtctggactcaggg
atacggcatagtgttggtgggggagattacggatctgtaagggtaggcacttacatggga
cgaaaaatgatcaagtgtgcagcatccgacttagcttcagaatcctcagtttctgatgct
cctgttcaatctaatgactataaacaaaatgccatagaactactgaaatccgaagcttcc
ctggagtatttgtgcaacataccacctcacagatatgaagctatttatgcaaaagatatt
ccagaggtcattactggagatgcatttttgaagaaatatggagatcacgatgatacagta
acagcaattgaccctaaaagatcttacaatgtgaaggctcctactaggcatcccatatat
gagaactttcgagttgagaccttcaaagcactcttagaagcagctaataccgatgagcaa
ttgtcagcccttggagaacttatgtaccagtgccactacagctataatgcatgtggtctt
ggttctgatgggactgatctgctagttaatctggtacaagaaatgcagcacagaaatatg
tcaaaaggtgaaagtcctagtctatttggtgctaagattaccggaggaggttccggaggc
tcagtttgcgtcatggggaaaaactgcctcaaaagcagtgaggagatcatcgagattcag
caaaggtacaaggcagcaactggctacctaccaatcctattcgatggatcatccccaggc
gctgccaaattcggctacctgaagatccgacgacgcccctcgtcaccaattgctgccaaa
tga

DBGET integrated database retrieval system