KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328364
Entry
4328364           CDS       T01015                                 
Name
(RefSeq) probable arabinose 5-phosphate isomerase
  KO
K06041  arabinose-5-phosphate isomerase [EC:5.3.1.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:osa01005]
    4328364
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.13  arabinose-5-phosphate isomerase
     4328364
Lipopolysaccharide biosynthesis proteins [BR:osa01005]
 Lipid A
  4328364
SSDB
Motif
Pfam: SIS CBS SIS_2
Other DBs
NCBI-GeneID: 4328364
NCBI-ProteinID: XP_015627385
UniProt: A0A0P0VF44 Q6ET44
LinkDB
Position
2:3179439..3182782
AA seq 344 aa
MGSLPVSSPECAPGRRVTVAASDLAPLFGAQRRHLDHFFDRLDLSQAAAFAQALVDAPGA
VFFTGVGKSGIVARKLAQTLASLGFTRAGFLSPVDALHGDIGSVFPGDLLVLLSKSGASD
ELLALAPCARAKGAHLISLTSAASGADCPLAAVCDLNVHLPLQAEVCPFGLAPVTSTAIQ
MVFGDTVVAAIMEARRLSRDQYASNHPAGKIGKSLIFKVKDVMKKQNELPLCKEGDMIMD
QLTELTSKGCGCLLVVDDEYHLIGTFTDGDLRRTLKASGQAIFNLTVGEMCNRHPRTITA
DAMAVQAMEKMESPPSPVQFLPVVDSNNVVCGIITLHGLVSAGL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgggctcgctccccgtgtcgtcgccggaatgcgcgccggggcggcgggtgacggtggcg
gcgtcggacctggcgccgctgttcggggcgcagcggcggcacctggaccacttcttcgac
cggctcgacctctcgcaggcggcggcgttcgcgcaggcgctggtcgacgcccccggcgcg
gtgttcttcacgggcgtcggcaagtccgggatcgtggcgcggaagctggcgcagacgctg
gcgtcgctcgggttcacccgcgcggggttcctgtcccccgtcgacgcgctccacggcgac
atcggctcggtcttccccggcgacctcctcgtcctgctctccaagtccggcgcctccgac
gagctcctcgccctcgcgccctgcgcccgcgccaagggcgcccacctcatctccctcacc
tccgccgcatccggcgccgactgcccgctcgccgccgtgtgcgatctcaacgtgcacctt
ccgctgcaggccgaggtgtgccccttcggcctcgctccggtgacctccaccgccatacag
atggtgttcggcgacaccgtcgtcgccgccatcatggaggctcgccgcctctccagggac
cagtacgcctccaaccaccccgccggcaagattggcaaatccctcatcttcaaggttaag
gatgttatgaagaagcaaaatgagcttccattgtgcaaggagggagatatgatcatggat
caactcactgaactcactagtaaaggctgtgggtgtctacttgtggttgatgatgagtac
catttgatcggaactttcactgatggtgatctccggcgtacactcaaggcaagtgggcaa
gcaattttcaatctgacagttggagagatgtgcaacaggcacccaagaacaatcaccgct
gatgcaatggcagtacaggccatggagaagatggaatcgcccccttctccggtgcagttc
ttgccagttgttgatagcaacaacgttgtctgtgggatcatcacattgcacggattggtc
tcagctggactataa

DBGET integrated database retrieval system