KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328375
Entry
4328375           CDS       T01015                                 
Name
(RefSeq) DExH-box ATP-dependent RNA helicase DExH11
  KO
K12599  antiviral helicase SKI2 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4328375
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4328375
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4328375
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     4328375
  mRNA degradation factors
   3'-5' decay
    Ski complex
     4328375
SSDB
Motif
Pfam: DSHCT rRNA_proc-arch DEAD Ski2_N Helicase_C AAA_22
Other DBs
NCBI-GeneID: 4328375
NCBI-ProteinID: XP_015626830
LinkDB
Position
2:complement(3237585..3249855)
AA seq 1376 aa
MGDLTTSSPASEVPFRVSFSGHGGHLRLDPTPNPPSPIPEFVLPPAYPLESPSSVKEYLE
ANYLNPELHLPTAADGARVWDLDWFELARPPLEPSAPRTMLVPAWEPPFRRRRPPLSSSS
SRQESQVWDPESVQMDMSDVFDSGTGGITPRMPGPAKDFVRGSVNSRPFRPGGLHDDAAA
AAALEKAFPEGARNGDWVRELMSGGPAQVNPPGFRKGLDLGNLKEYKSHWKCYQDGERVD
EQSTSSSNDTMDKYSVQFDDLFKIAWEEDSDDKVPREDHVQQLVGDEETNDVDKQNISKL
QNASETIENLDIEKQKGGAQGDVSEPQSDLDQMLLSSVKDTSRDSSGSGDGSMAKEGKVW
ALVGGDEDIVTNFYKLVPDMAIEYPFELDKFQKEAIYYLQKGESVFVAAHTSAGKTVVAE
YAFALATKHCTRAVYTAPIKTISNQKYRDFCGKFDVGLLTGDVSIRPEATCLIMTTEILR
SMLYRGADIIRDIEWVIFDEVHYVNDAERGVVWEEVIIMLPKHINIVLLSATVPNTVEFA
DWIGRTKQKKIHVTSTNKRPVPLEHCLFYSGEVFKICEKDAFLTQGYREAKEVFKKKNSS
KLGMKPGSKPGTTAVRAGTQGRNPDTSSRGRDQKNPKHHHASSSAAAVQQSTSGPRRSES
SFWMPLINNLLKKSLVPVVIFCFSKNRCDRSAESMFGADLTSNSEKSEIRLFCDKAFSRL
KGSDRNLPQVVGIQSLLRRGIGVHHAGLLPIVKEVVEMLFCRGVIKVLFSTETFAMGVNA
PARTVVFDSLRKFDGKEHRKLLPGEYIQMAGRAGRRGLDNIGTVIVMCRDEIPEESDLKN
LIVGKPTRLESQFRLTYTMILHLLRVEELKVEDMLKRSFAEFHAQKNLPEKEKLLLQMLR
QPTKTIECIKGEPAIEEYYEMVLEAEAHRESITEAIMQLPASQQSLTPGRLVVVKSQSDD
DHLLGVIVKTPSAALKQYVVLVLTGDCTSSALAPDSSNQNEKEAGDFKQGYFVIPKGKRS
MEDEYFSSVSTRKGSGVINIKLPYKGDASGMGFEVRAIENKEIMNICASKIKIDQVRLLE
DPSKTVYSKTVQMLIKEQPDGNKYPAALDAIKDLKMKDMLLVENYYAYQRLLQKMSENKC
HGCIKLKEHIALMKEQKVYKDQLNDLKYEMSDEALQQMPEFQGRIDVLKEIHYIDSDLVV
QLKGRVACEMNSGEELISTECLFENQLDDLEPEEAVAIMSALVFQQRNTSEPSLTPKLAD
ARKRIYDTAIRLGKLQREFKVPVDPEEYARDNLKFGLVEVVYEWAKGTPFADICELTDVS
EGLIVRTIVRLDETCREFRNAASIMGNSALHKKMETASNAIKRDIVFAASLYVTGI
NT seq 4131 nt   +upstreamnt  +downstreamnt
atgggcgacctcaccacctcgtcgccggcgagcgaggtgccgttccgcgtcagcttctcc
ggccatggcggccacctccgcctcgaccccacgcccaatccgcccagccctatacccgag
ttcgtcctgccgccggcgtacccgctggagagcccgagcagcgtgaaggagtacctcgag
gccaactacctcaacccggagctccacctccccaccgcggccgatggcgcgagggtgtgg
gatttggattggttcgagttggctaggccgccgctggagccctccgccccgcgcaccatg
ctcgtgcccgcctgggagccgcccttccgccgccgacggccgccattgtcgtcgtcgtcg
tcgcggcaggagtcgcaagtgtgggatcctgagtccgtgcagatggatatgagcgacgtg
tttgattcgggcaccggtgggataacgccgcggatgcctggccctgcgaaggatttcgtg
agggggagcgtgaacagccgcccgttccgcccagggggcctgcatgatgatgcggctgcg
gctgctgctttggagaaggcatttccagagggtgcacgcaatggggattgggtgcgcgag
cttatgagcggagggccagctcaggttaatcctccaggattccgcaagggattggacctg
ggcaatttgaaggagtacaaaagccattggaagtgttaccaggatggagagcgtgtagat
gagcaatccacatcttcatcaaatgacaccatggataagtactcagtgcagtttgatgat
ctattcaagatagcatgggaggaagattctgacgacaaggtgccgcgtgaagatcatgtt
cagcaattggttggagatgaggagaccaatgatgttgataaacaaaatattagcaaactg
caaaatgcttctgaaactatagaaaatctggacattgaaaaacagaaaggtggtgcccaa
ggagatgtttctgaacctcaatcagacttggatcaaatgttattgtcctcagttaaagat
actagcagagattcaagtgggtcaggtgatggcagcatggcaaaggagggcaaggtttgg
gcacttgttggtggggatgaagacattgtgactaacttctataaacttgttccagatatg
gcaattgagtatccatttgaactagacaaattccagaaggaggctatatattatcttcag
aagggtgaatcagtctttgtggcagctcatacatcagcaggaaagacggttgttgcagag
tatgcattcgctttagcaacaaaacattgcacccgggctgtctatactgctcccattaaa
actatcagcaatcaaaaataccgagatttctgtgggaagtttgacgtgggacttctcaca
ggagatgtcagtatcagaccagaggcaacttgcttaattatgaccacagaaatattacgt
tcaatgctctacagaggtgctgacatcatacgtgatattgaatgggtaatttttgatgaa
gtgcattatgtaaatgatgcagagagaggtgtagtttgggaggaagttattataatgctc
ccgaagcacatcaacattgtccttctttcggcaacggttccaaacacagttgaatttgct
gactggattggtcgaacaaagcagaagaaaattcatgtcacatcgaccaacaaaaggcct
gttcccctggagcactgtttgttctactccggagaagtgttcaaaatatgtgagaaggat
gcatttcttactcaaggatatagagaagccaaggaggtttttaaaaagaaaaattcgagc
aagcttggaatgaaacctggttcaaaaccaggaacaactgcagtacgtgctggaactcaa
ggcagaaatccagatacatctagtagaggtagagatcagaaaaatccaaagcaccatcat
gccagctcatcagctgctgctgttcagcaaagcacctctgggccacggagatcagagtct
tcattctggatgcccctcataaataaccttctgaagaaatccctcgtgcctgtggtaatt
ttttgcttctcaaaaaatcgatgtgatagatcagcagagagcatgtttggtgcagatctc
accagtaactcagagaaaagtgaaatccgcctcttctgtgacaaggccttttcacgcctt
aaaggatctgataggaaccttccacaggttgtagggatacaaagccttctacgtagaggg
attggagtacaccatgctggacttcttcctatcgtcaaagaagttgttgaaatgctgttt
tgtcgtggcgtcatcaaggtgttattttccactgagacatttgcgatgggcgttaatgct
ccagcaaggacggtcgtgtttgattccttaagaaagtttgatggaaaagaacatcggaag
ttacttccaggggagtatattcaaatggccgggcgagctggtaggagagggcttgataac
attggtacagtgatcgttatgtgtcgtgatgaaattcccgaagaaagtgatttgaagaat
ttgattgttggaaaaccaactcgactagaatctcaatttcggttaacatacactatgata
ctgcatcttctacgtgtggaggaactcaaggtggaggacatgctaaagagaagttttgca
gaattccatgcacaaaagaatttgcctgagaaggaaaagttgcttctgcagatgcttcgt
caacccacgaagacaattgagtgcataaaaggagagccggctattgaagaatactacgag
atggtcttagaagctgaggcacacagggagtctattacggaagcaattatgcagttgcct
gcttctcaacagtcccttacacctggccgtctggttgttgttaaatcccaatcagatgat
gatcacttgctcggtgtaattgtgaaaactccatctgctgcactaaagcaatatgttgtt
cttgtactgaccggtgattgcacatcgtcagcactagctcctgattcatccaaccagaat
gaaaaggaagcaggggattttaaacaaggatactttgttatcccgaaaggaaaacgtagc
atggaagatgaatatttctcttctgtcagtacacggaaaggttcaggtgtcatcaatatc
aagctaccatacaagggagatgcatctggaatgggttttgaagttagagcaatagagaat
aaagagattatgaatatatgcgccagcaaaataaagattgatcaagtcagactccttgag
gatccaagcaaaacagtttactctaaaactgtccagatgcttataaaagagcaaccagac
ggaaacaagtatcctgctgctttagatgcaataaaagatctaaaaatgaaagacatgctt
ctcgttgagaactactatgcttaccagagattactgcaaaaaatgtctgaaaataagtgc
catggttgtataaaattaaaggagcatattgcattgatgaaggagcaaaaggtgtacaag
gatcagctgaatgatttgaaatatgaaatgtcagatgaggcacttcaacagatgccggag
tttcaaggcagaatcgatgtactaaaagaaatccattacattgattctgatctagtggtg
caacttaagggccgagtggcctgcgaaatgaattccggcgaggagttgatatcaaccgaa
tgtctgtttgagaatcagttggatgacctagaacctgaagaagccgtagctattatgtct
gcattggtcttccaacaaaggaatacatcagaaccatctcttaccccgaaactagcagat
gccagaaagaggatttatgatacagcaatcagattaggaaagctccagagagagttcaag
gtgcctgtagatcccgaggaatatgcccgtgataatctcaagttcggtcttgttgaagtc
gtctacgaatgggcaaaggggaccccatttgcagacatctgtgagctgacagatgtatct
gaaggtctcattgtaagaacaatcgtgcggttggatgaaacttgcagggagttcaggaat
gcagcttccataatggggaactccgcgttgcataagaaaatggagactgcgtccaatgcc
attaagcgtgacatcgtctttgcagcaagcttgtatgtcacagggatatga

DBGET integrated database retrieval system