KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328433
Entry
4328433           CDS       T01015                                 
Name
(RefSeq) ribonuclease H2 subunit C
  KO
K10745  ribonuclease H2 subunit C
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4328433
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4328433
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    4328433
SSDB
Motif
Pfam: RNase_H2_suC
Other DBs
NCBI-GeneID: 4328433
NCBI-ProteinID: XP_015627259
UniProt: A0A0P0VF90
LinkDB
Position
2:complement(3718321..3720172)
AA seq 161 aa
MEPAAAAAAVTAAVDLSTAAADLGRVHLLPCGIKQNGAAAVSDYFKPKDTGVEVEGIRVE
EAFFRGRKLQGATISLPDGYRGYVLEKRSGGKDMKKLEGEVSNFKSRAEFQNITYWNHDT
TPSAEDPLPRCFHLLTVANAMHKPVTAEEMAYMSAMQNQSS
NT seq 486 nt   +upstreamnt  +downstreamnt
atggagccagccgccgccgccgccgccgtcacggccgccgtcgacctgtccacggcggcc
gccgacctcggcagggtgcacctcctcccctgcggcatcaagcagaacggcgccgccgcc
gtctccgactacttcaagcccaaggacacaggtgtggaggtggaggggattagggtggag
gaggccttcttccgcgggaggaagctgcagggcgccaccatctcgctcccggatggctac
cgaggttatgtattggagaagaggagtggaggaaaggatatgaagaagctggagggggag
gttagcaatttcaaatcccgtgcggagtttcaaaacataacatattggaatcatgatacc
acaccatcggcagaggatcccctaccgcggtgctttcatttgctaaccgttgctaatgct
atgcacaagccagtgaccgctgaagagatggcttacatgtccgcaatgcagaatcagagc
agttaa

DBGET integrated database retrieval system