KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328435
Entry
4328435           CDS       T01015                                 
Name
(RefSeq) phosphoglycerate kinase, cytosolic
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4328435
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4328435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4328435
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     4328435
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4328435
SSDB
Motif
Pfam: PGK
Other DBs
NCBI-GeneID: 4328435
NCBI-ProteinID: XP_015625860
UniProt: Q6H6C7 B9EZR6
LinkDB
Position
2:3727472..3731228
AA seq 402 aa
MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI
LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLEN
VRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHASTEGVTKFLKPAVAGFLMQKEL
DYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVGK
SLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLDV
GPDAIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAIAKKLADLTTTKGATTIIGGGD
SVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALDEA
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcgacgaagaggagcgtggggacgctgggggaggcggatctgagggggaagaaggtg
ttcgtgcgggccgacctcaacgtgccgctcgacgacgcccagaagatcaccgacgacacc
cgcatccgcgcgtccgtgcccactgtcaagttcctcctcgagaagggcgccaaggtcatc
ctcgccagccatctgggccgtccgaagggtgtcacccccaagtacagcttgaagcctctt
gttccacgcttgtctgagctacttggagtcgatgttgtgatggccaatgattgcattggt
gaggaagttgagaaattggctgctgctttgccggaaggtggtgttctactcctagagaat
gttagattctacaaggaggaagaaaagaatgatcctgagtttgccaagaagcttgcagct
gtcgctgacctctatgtaaatgatgcttttggcactgcacacagagctcatgcttcaact
gagggagtgaccaaatttttgaagcctgctgttgctggcttcctgatgcagaaggaactt
gactatcttgttggagctgttgcaaacccaaagaagccatttgcggccatcgttggtgga
tccaaggtctcaactaagattggggtgattgagtctctgttggcaaaggttgatgtcctc
atccttggtggtggtatgatcttcacattctacaaagcccagggatatgctgttggaaaa
tctcttgtggaggaagacaaacttgagcttgcaacttcacttattgagaaggcgaaggcg
aagggtgtttctctcttacttcctaccgatgttgtagtggctgacaagtttgccgcagat
gctgaaagcaagactgttgctgcctccgctatccccgatggttggatgggtcttgatgtt
ggcccagatgccatcaagacttccagcgaagcattggacacctgcaacactatcatttgg
aacggacctatgggagtctttgagtttgagaagtttgcagcaggcactgatgcaattgcc
aagaagttggctgatcttactaccacaaagggcgccacgaccatcatcggtggtggtgac
tccgttgctgcggtcgagaaggctgggctggccgacaagatgagccacatctccaccggc
ggtggtgctagcttggagttgctggaaggcaagaccctcccaggtgttcttgcccttgat
gaagcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339204
Entry
4339204           CDS       T01015                                 
Name
(RefSeq) phosphoglycerate kinase, chloroplastic
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339204
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4339204
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339204
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     4339204
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4339204
SSDB
Motif
Pfam: PGK
Other DBs
NCBI-GeneID: 4339204
NCBI-ProteinID: XP_015639410
UniProt: A0A0P0WP33
LinkDB
Position
5:complement(24378999..24381738)
AA seq 484 aa
MASAAAPTTSSLSLAARRAAAVGPAAASPLRRGGLAAGCQPARSLAFAAAADPRLATHVA
SRCRQAASSSSRGTRAVATMAKKSVGDLTAADLEGKRVFVRADLNVPLDDNQNITDDTRV
RAAIPTIQYLIKNGAKVILSSHLGRPKGVTPKFSLAPLVPRLSELLGIQVTKAEDVIGPD
VEKLVSELPNGSVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEG
VTKFLKPSVAGFLLQKELDYLVGAVSSPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLL
GGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKEKGVSLLLPSDVIIADKFAPDAN
SQVVPASAIPDGWMGLDIGPDSVASFSSTLETTQTVIWNGPMGVFEFDKFAVGTEAIAKK
LADLSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALDEAV
TVAV
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcgtccgcggccgcgccgaccacgtcctcgctctccctcgccgccaggcgcgccgcg
gcggtggggcccgccgccgcgtcgccgctacggcgcggggggctggcggccgggtgccag
ccggcgcggtcgctggcgttcgcggcggccgcggacccgcggctggcgacccacgtcgcg
tcgcggtgccggcaggcggcgtcgtcgtcctcgcgcgggacgcgcgccgtcgccaccatg
gcgaagaagagcgtcggggacctcaccgccgccgacctcgaggggaagcgcgtgttcgtg
cgcgccgacctcaacgtcccgctcgacgacaaccagaacatcaccgacgacacccgtgtc
cgcgccgccatccccaccatccagtaccttatcaagaacggtgccaaggtcatcctctcc
agccacctgggtcgcccaaagggtgttactcccaagtttagcttggctccccttgtaccg
cgattgtctgaacttctcggcatacaggtgactaaggcagaagatgttattggaccagat
gttgagaaattggtatctgaattgccaaatggtagtgttttgctccttgaaaatgttaga
ttttacaaggaagaggagaagaatgacccagagtttgccaagaagcttgcctccttagca
gatctctatgtcaatgatgcattcggaacagcccacagagcacatgcatcaactgaggga
gttaccaagtttttaaagccttctgtcgcaggattccttttgcagaaggagcttgactac
cttgttggagctgtttcaagccctaaacgcccatttgctgccatcgtgggtggttcaaag
gtgtcatccaagattggggttatcgaatcccttttggagaaatgtgatatccttcttcta
ggtggtggtatgatcttcacattttacaaggcacaaggactctctgttggttcttccttg
gttgaggaagacaaacttgagcttgcaacatctctccttgcaaaggcaaaagaaaagggt
gtctcccttctgttgccatctgacgttatcattgctgataagtttgctcctgatgctaac
agccaggttgttccagcatctgctattcctgatggttggatgggtctggatattggtcca
gattcagtcgcgtcattcagctctaccctggaaacaacacagacagtcatttggaatgga
cctatgggtgtcttcgaatttgacaagtttgcagtaggaactgaggctattgcaaagaag
ttggcagaccttagcggcaagggtgttacaaccattattggaggaggtgattctgttgcc
gctgttgagaaggtgggagttgcagatgttatgagccacatttcaacgggaggtggtgct
agcttggagctgttggaaggaaaggaacttcctggagtcattgcacttgatgaagctgtc
actgtggccgtatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341792
Entry
4341792           CDS       T01015                                 
Name
(RefSeq) phosphoglycerate kinase, cytosolic
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4341792
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4341792
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341792
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     4341792
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4341792
SSDB
Motif
Pfam: PGK PrpR_N
Other DBs
NCBI-GeneID: 4341792
NCBI-ProteinID: XP_015644193
UniProt: Q655T1 A3BEG0
LinkDB
Position
6:complement(27676391..27679825)
AA seq 401 aa
MASKRSVGTLTESDLKGKKVFLRADLNVPLDDSQKITDDTRIRASVPTIKFLMGKGAKVI
LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVQKLAATLPDGGVLLLEN
VRFYKEEEKNDPEFANKLASVADLYVNDAFGTAHRAHASTEGVTKYLRPSVAGFLMQKEL
DYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDILILGGGMIYTFYKAQGYAVGK
SLVEEDKLELATSLIEKAKSKGVSLLLPTDIVVADKFAADAESKTVPASAIPDGWMGLDI
GPDSIKTFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAIAKKLADITAKGVTTIIGGGDS
VAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALNDA
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcgagcaagaggagcgtgggcaccctgacggagtcggatctgaaggggaagaaggtg
ttcctccgcgccgatctgaacgtgccgctggatgacagccagaagatcaccgacgacacc
cgcatccgcgcgtcggttcccaccatcaagttcttgatggggaagggcgccaaggtcatc
ctggccagccatctgggtcgcccaaaaggtgtaaccccgaagtacagcttgaagcctctt
gttccgcgcttgtctgagcttcttggtgttgatgttgtgatggccaatgactgcatcggt
gaggaagtccagaaattggctgccactttaccagatggtggtgttctgcttctagaaaat
gttcggttctacaaggaggaagagaaaaatgaccctgaattcgccaataagctggcatct
gttgctgacctttatgtaaatgatgcctttggcacagcacacagagctcatgcttcaaca
gagggagttacgaagtatttgagaccttctgttgctggtttcctcatgcagaaggaactt
gactatcttgttggagctgttgccaaccccaaaaaaccatttgctgccattgttggtgga
tccaaggtgtcaacaaagattggggtgattgagagtcttttggcaaaggttgacatcctc
atactgggtggtggtatgatctatacattttacaaggctcagggatacgctgttggaaaa
tctcttgtggaggaagacaagctcgaattggctacctcgcttattgaaaaagccaagtca
aagggagtctccctattgcttccaactgatattgtagtagctgataagtttgctgcggat
gcagagagcaagactgttccagcatctgctatccctgatggttggatgggccttgatatt
ggcccagactccatcaagactttcagtgaaactttggatactaccaagactgtcatctgg
aatgggcctatgggagtgttcgagtttgagaaattcgctgctggcactgatgcaattgcc
aagaaattggctgatatcaccgccaaaggtgttacaacgatcattggaggtggcgattct
gttgctgctgtcgagaaggccgggttggcggacaagatgagccacatttcaacgggaggt
ggcgcgagcttggaactgttggaaggcaagaccctcccaggagtccttgctcttaatgac
gcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348728
Entry
4348728           CDS       T01015                                 
Name
(RefSeq) phosphoglycerate kinase isoform X1
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4348728
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4348728
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4348728
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     4348728
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4348728
SSDB
Motif
Pfam: PGK Methyltransf_4 Methyltransf_25 Methyltransf_31 Methyltransf_32 MTS MCM3AP_GANP
Other DBs
NCBI-GeneID: 4348728
NCBI-ProteinID: XP_015614720
UniProt: Q337T1
LinkDB
Position
10:complement(15884476..15893640)
AA seq 673 aa
MQKACSVQLLRPSRSRRRESWPQSGGSVVTGRPCYLRGSRGLSRLNGMVLCFQPPQSASV
VHLEGEDKYSCIDHSTSYLHVQSVRDFPIEKLNAEVVLVRLDSELICNPLGSCSLSLERT
VSTIKYLQKAGAKVLLVTSWTPVLQSVYPVLKSTETFADYMSSLLQVKVVPVNGVPGLTS
FKPEGWMQNDIILFENLLNFKGENANCNDFSQKLASGAAIFVNDSFSLSHKMLASTVGIT
RFCHASLAGFHFEEELMQLRKITDTTRRPFIAIIGGSNFLGKAPALNLLASLCDGLFFVG
KLSLQIMNGFGIPVPSCFVEKNSTKEVLQLIQTAHNRNIPIYYPTDTWCLNNKNNNHEKL
EILDSAELLPGWTPADIGPSTLEKISSLMPLYKKVLWIGPTCFDLTEEFSGGAAQLGRIL
DKASHDSCDVILVGSAACKAVKGISGSSSKYTTFKNASVVLEFLKGKILPGVAALDKSYP
YQIPWNAIFSDSSQPLVVDIGSGNGLFLFQMARDWEGSNFLGLEMNKKLVVRCLRDVASV
DKRNLYFVSTNATSTFRSIVSSYPGQLALVTIQCPNPDFNREQNRWRMVRRMLVEAIADL
LQPNGKVYLQSDVESVLLRMKEQFMTHGKGQLVVDDDGGGDHQMDNPFGAASDWERHVLA
RGAPMYRTMLRKV
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgcagaaggcttgcagcgtccagttgttgaggccatcgaggtctcgtcggcgagaatca
tggccacaatcgggtggatccgtggttacaggacgtccttgttacttacggggaagtcgc
ggactatccaggcttaatggtatggtactgtgctttcagccaccgcaatctgctagtgtg
gttcatcttgagggagaggacaaatattcttgtattgatcattcaacatcatatctgcac
gtgcaatctgttagggatttccccattgaaaaactcaatgcagaggtggttctggtgcga
cttgattccgaactgatctgtaatcctctaggatcatgtagtttgtcgctggaaaggact
gtgtcaactatcaaatacttgcaaaaagctggagcaaaagtgcttctggtcaccagttgg
actcctgttcttcaatctgtttacccagtactcaagtcaactgaaacttttgctgactat
atgtcatcgcttcttcaagtaaaagtggtcccagtaaatggtgtgcctggtttaacatca
tttaagccagaagggtggatgcagaatgacattattttgtttgaaaatcttttgaacttc
aaaggagaaaatgcaaactgcaatgatttttctcagaagctcgcttcaggtgctgcaatc
tttgtcaatgattctttctcactgtctcataagatgctagcatctactgttggcatcact
cgcttctgccatgcatcccttgctggtttccattttgaggaggagcttatgcaattgaga
aagatcacggacaccacaaggcgcccattcattgcaataattggaggcagtaacttcttg
ggaaaggcacctgctctgaatctgttagcctctctatgtgatggattattctttgttggc
aaattgtcattgcaaataatgaatggctttggaataccagtgccctcttgttttgtagaa
aagaattcaactaaggaagtgctacaacttatacaaacagctcataacaggaatattcct
atttattatccaactgacacctggtgtttgaacaacaagaacaacaatcatgaaaagttg
gaaattctcgactctgctgaactattgcctggctggacaccagctgatatagggccatca
acattggagaaaatttcctcgttaatgccattatacaagaaggtcctatggattgggcca
acatgttttgatttaacagaagagttttctggtggggcagcacagttgggcaggatactg
gacaaggcaagccatgatagctgcgatgttattttagtggggagtgcagcatgcaaggca
gtaaaaggaatatcaggatcatcatcaaaatatacaacatttaaaaatgcatctgttgtt
ttggaattcctgaaaggaaaaatattgcctggtgttgcagcattggataaaagttatccc
tatcagataccatggaatgctatcttttctgattcttcacaaccgttagtggttgatatt
ggaagtggaaatggtttatttctttttcaaatggctagagactgggaaggctccaatttt
cttgggcttgagatgaataaaaagcttgttgtaaggtgccttcgggatgttgcttcagtt
gacaaaaggaatctatattttgtttcaacaaatgcaacatccacatttcgatcaattgtt
tcaagttaccctggacagttggctcttgtcactatacagtgcccaaatcctgatttcaac
agagagcagaacaggtggagaatggtacgaagaatgcttgttgaagctattgctgatctt
cttcagcccaatggaaaggtttatctgcagtctgacgtggagtccgtcctgctcagaatg
aaagagcagttcatgacgcacggcaagggccagctggtggtggacgacgatggcggcggc
gaccaccagatggacaacccgttcggcgctgcgtctgactgggagcgccatgtgctggct
cgtggagctcccatgtacagaacgatgctacgcaaagtgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268592
Entry
9268592           CDS       T01015                                 
Name
(RefSeq) phosphoglycerate kinase, chloroplastic
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    9268592
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    9268592
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9268592
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     9268592
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   9268592
SSDB
Motif
Pfam: PGK Anticodon_3
Other DBs
NCBI-GeneID: 9268592
NCBI-ProteinID: XP_015622294
LinkDB
Position
1:33884562..33887693
AA seq 231 aa
MASVAATTFPSMARPAARGIVAGAAASTVPLPRAGVASPCPTARSLGFAARGTDPRLAIH
VSSRRRAASASAGSRLARAVATMAKKSVGDLAAADLEGKRVLLRADLNVPLDASQNITDD
TRVIAAIPTIKHLIGNGAKVILCSHLGRPKGITPKFSLAPLVPRLSELLGIQVQKADDVI
GPEVEKSVSVLPNGSVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAF
NT seq 696 nt   +upstreamnt  +downstreamnt
atggcgtcggtggccgctaccactttcccctccatggcccgccccgcggcccgcgggatc
gtggccggcgccgccgcctccaccgtgccgcttccccgcgctggcgttgcctccccgtgc
ccgacggcgcgctcgctgggcttcgcggcccgcgggaccgacccgcggctggcgatccac
gtctcgtcgcggcgtcgagcggcctcggcgtcggcggggagccgcctggcgcgcgccgtg
gcgacgatggcgaagaagagcgtgggcgacctggcagccgcggacctcgaggggaagcgc
gtgctcttgcgcgccgacctcaatgtgcccctcgacgccagccagaacatcaccgacgac
acccgagtcatagccgccatccccaccatcaaacacctcattggcaacggggccaaggtc
atcctttgcagccacttgggccgtcctaagggtatcactcccaaatttagcttagctcct
cttgtaccaaggttatctgaacttcttggcatacaggttcaaaaggcagatgatgttatt
ggtccagaagttgagaaatcggtctctgtgctgccaaacggcagtgttttactgcttgaa
aatgtcagattttacaaggaggaggagaagaatgacccagagtttgcgaagaagcttgcc
tccctcgctgatctttatgtaaacgatgcattttga

DBGET integrated database retrieval system