KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328504
Entry
4328504           CDS       T01015                                 
Name
(RefSeq) U2 snRNP-associated SURP motif-containing protein isoform X1
  KO
K12842  U2-associated protein SR140
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328504
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4328504
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    4328504
 Complex B
    4328504
SSDB
Motif
Pfam: Surp RRM_1 cwf21 CID CTK3 RRM_7 SAP
Other DBs
NCBI-GeneID: 4328504
NCBI-ProteinID: XP_015626318
UniProt: Q6ETK6
LinkDB
Position
2:4440177..4448759
AA seq 954 aa
MSSKKVPFHRHKENEEARKKREQDEAARVYEEFVESFKGDSTSGSKFVRGGVIDPNAKLR
IDSEGGKSKDGGSVPKKGSRYVPSFLPPSFGKEPDKKKEEERPKEKERRKPRVIDEFMEE
LKFEKELRQKRNQEREQWREGRHTDTSASSSRFDELPDELDPIGKLPGSFDDGDPQTTNL
YVGNLSPKVDENFLMRTFGRFGPIASVKIMWPRTEEERRRQRNCGFVAFMNRADGQAAKD
EMEGVVVYDYELKLGWGKSVALPSQALPAPPPGHMAIRNKEGGTVILSGPGGPPLASVKP
QTSELVLTPNVPDIVVAPPDDAHVRHVIDTMALHVLDGGCAFEQAVMERGRGNSLFSFLF
DLKSKEHTYYVWRLYSFAQGDTLQRWRTEPFIMITGSGRWVPPALPSSRSPEREKESTFA
AGRSRRVEVERTLTDSQRDEFEDMLRALTLERSQIKEAMGFALDNADAAGEIVEVLTESL
TLKETPIPTKVARLMLVSDILHNSSAPVKNASAFRTKFEAALPDVIESFNDLYRSITGRI
TAEALKERVLKVLQVWADWFLFSDAYLNGLRATFLRSSHLGVIPFHSLCGDTPEIEKKAS
SEDGSDGFRLNEDGALATGKAAATRELLGLPLAELERRCRHNGLSLCGGKEMMVARLLSL
EEAEKERVYEKDAGIKYGQGESHRTGRDDIAVNARNASRPGEGTDSGESDMLGLSHYAME
AGYKRSNESTPAEPVPSKKPKVDPVLPASKWSREDDVSDDEDRKGGRGLGLSYSSGSDIA
GDSGKADATEVSTDHSNHHQDTILDEEHRKKLRQIEIAVMQYRESLEEKGLRNTEEIEKK
VASHRRRLQSEYGLSFSNDGANSRRSSERTSSERRDRHDDSSRKRHRSLSRSRSPPRRSL
ERDREHNRNRDTDRSHGNDAGRERDRVREKSASRGRDDHYDRSRDREKDRRKGR
NT seq 2865 nt   +upstreamnt  +downstreamnt
atgagttcgaagaaggttccattccaccgacataaggagaacgaagaggcgaggaagaag
agagagcaagatgaagcggcacgtgtgtacgaggaatttgtggagtcattcaagggtgat
agcacatctgggtcgaagtttgtccgaggaggtgtgattgatcccaatgccaagctgagg
attgattccgaaggtggaaagtccaaagatggggggtctgttccaaagaagggcagtagg
tatgttccatcttttttgccgccgtcatttgggaaagagccggacaaaaagaaagaagag
gagcgtccaaaggaaaaggaaagacgaaagccacgggtaatagacgagttcatggaggag
ctcaagtttgagaaagagcttcgacaaaagcgtaatcaggaacgcgagcaatggcgtgag
ggtcgacacactgacacatctgcttcctctagccgttttgatgaactaccagatgaatta
gatcccattgggaaacttccaggatcatttgatgatggggatccacaaaccacgaactta
tatgttgggaatctttctcctaaggtggacgagaattttcttatgaggacatttggtcgt
tttggacctattgctagtgtcaagattatgtggcctcgaacagaagaggaacgcagaagg
caaagaaattgtggttttgttgccttcatgaatagggctgatggacaagcagccaaggat
gaaatggaaggtgttgttgtgtacgactatgaactgaaactagggtggggcaaatctgtt
gctcttccttcacaagcactgcctgctcctccaccagggcacatggcaatccggaataag
gagggtggtactgtcatcttatctggtcctggtggtccacctcttgcatctgttaaacca
cagacctcagagctggtcctcacaccaaatgttcctgatatagtggttgctccgccagat
gatgcacatgttcggcatgtgattgacacaatggctctgcatgtacttgacgggggatgt
gcttttgaacaagctgttatggagagaggccgaggaaattctttatttagtttcttgttt
gatcttaaatcaaaggagcacacatactatgtttggaggctatactcatttgctcagggt
gatactttgcagcggtggagaacagaaccatttatcatgattacaggaagtggaagatgg
gttccacctgctttgccatccagcagaagtcctgagcgtgaaaaagaatctacttttgcg
gctggtagaagcaggcgtgtcgaagtggagcgcacattgactgattcacagcgtgatgaa
tttgaggacatgctacgtgcattgacattggagagaagtcagataaaggaggctatggga
tttgcattggataatgctgatgcagctggagagattgttgaagttcttacagaatctttg
acactcaaggagacacccatcccaaccaaggttgctcggcttatgctagtgtctgatatt
cttcataacagcagcgctccagtgaagaatgcttctgcattccggacaaagtttgaggct
gctctacctgatgttatagaaagcttcaatgatttataccgcagtatcactggaaggatt
actgctgaagctctgaaggagagagttttgaaagttctacaagtatgggcggactggttc
ttattttccgatgcatatctgaatggactaagagctacctttcttagatcaagccactta
ggggtcatcccttttcactctctatgtggtgatacaccagaaattgaaaagaaagctagc
tctgaggacggcagtgatggatttaggctcaacgaagatggtgccttggccacaggaaag
gcagcggcaacaagggagctgttagggcttccgctagctgaacttgaacgccgttgcaga
cataatggcctctcgctatgtggtggtaaagagatgatggttgccaggttgcttagcttg
gaagaggctgagaaggaacgagtatatgagaaggacgcgggcattaaatatggacaagga
gaatcgcatagaactggaagagatgacattgctgtgaatgctcgtaatgcttctagacct
ggagaaggtactgatagtggtgaatcagacatgttgggtctctctcattatgctatggaa
gcagggtacaaacgctctaatgaatccacacccgctgaacctgttccaagcaagaagcca
aaagttgaccctgttttgcccgcttcaaaatggagtcgagaggatgatgtcagcgatgat
gaagatagaaaaggtggcagaggcttaggattaagctattcatctggtagcgatattgct
ggtgattctgggaaagctgatgcaacagaagttagtactgatcactcgaatcatcaccag
gatacgattcttgatgaagagcatagaaagaagttaaggcagattgaaattgctgttatg
cagtatcgtgaatctcttgaggagaagggtttgcgaaacacagaagagattgagaagaag
gttgccagccaccgtaggcgtcttcagtctgaatatggtttatcattttcaaatgatggt
gcaaacagcaggcgctcttctgagaggacatcgtcggagcggagagataggcatgatgat
tcttcaagaaagcgtcatcgaagcctgagcaggagccgtagtcctccaaggagatcactg
gaaagagatcgagagcacaatcgcaacagagacacagacagatctcatggtaatgatgct
ggacgagagagagacagggtacgtgaaaaaagcgcaagccgagggagggatgatcactat
gatagaagcagagacagggagaaggacaggagaaagggaaggtga

DBGET integrated database retrieval system