KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328598
Entry
4328598           CDS       T01015                                 
Name
(RefSeq) citrate synthase 4, mitochondrial
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
osa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4328598
   00630 Glyoxylate and dicarboxylate metabolism
    4328598
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     4328598
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-GeneID: 4328598
NCBI-ProteinID: XP_015627140
UniProt: A0A0P0VFT1 Q7F8R1
LinkDB
Position
2:complement(5242812..5249321)
AA seq 472 aa
MAFFRGLTAVSRLRSRVAQEATTLGGVRWLQMQSASDLDLKSQLQELIPEQQDRLKKLKS
EHGKVQLGNITVDMVLGGMRGMTGMLWETSLLDPDEGIRFRGLSIPECQKVLPTAVKDGE
PLPEGLLWLLLTGKVPTKEQVDALSKELASRSSVPGHVYEAIDALPVTAHPMTQFTTGVM
ALQVESEFQKAYDKGMSKSKFWEPTYEDCLNLIARLPAVASYVYRRIFKGGKTIAADNAL
DYAANFSHMLGFDDPKMLELMRLYITIHTDHEGGNVSAHTGHLVGSALSDPYLSFAAALN
GLAGPLHGLANQEVLLWIKSVIGETGSDVTTDQLKEYVWKTLKSGKVVPGFGHGVLRKTD
PRYTCQREFALKYLPEDPLFQLVSKLYEVVPPILTELGKVKNPWPNVDAHSGVLLNHFGL
SEARYYTVLFGVSRSIGIGSQLIWDRALGLPLERPKSVTMEWLENHCKKVAA
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcgttcttcaggggcctgaccgcggtgtcgaggcttcgatcccgcgtggcacaggag
gccaccacgcttggtggtgtgcgatggctgcagatgcagagcgcatctgatcttgatctc
aagtcccagctgcaggaattgattcctgaacaacaggaccgcttaaagaaacttaaatcg
gagcatggaaaggtccaacttggaaatataacagtcgatatggtccttggtgggatgaga
gggatgactggaatgctttgggaaacatcattgcttgacccggatgagggtattcgtttt
aggggtctctcgattccagagtgccagaaagtgctgccgacagcagttaaagatggggag
cctttgcctgagggtctactttggcttcttttgaccggaaaggtgccaaccaaagagcaa
gttgatgctctatcaaaggaattggctagtcgttcgagtgttccaggtcatgtgtatgag
gcaatcgatgctcttcctgtaactgctcatccgatgacccagtttaccacaggagtgatg
gcacttcaggtggagagtgagtttcaaaaagcctatgacaaaggaatgtcaaaatcaaag
ttctgggagcctacctatgaagattgcttaaatttgatagctcgccttccagcagtggct
tcatatgtttaccggaggatattcaagggagggaaaactatagcagctgataatgcactg
gattatgcagcaaatttttcacacatgcttgggtttgatgatcccaaaatgcttgagttg
atgcgactatatataacaatccacactgatcatgaaggtggaaacgtcagtgctcatact
ggacatctggttggaagtgctctgtcagacccttatctttcttttgcagctgcactgaat
ggtttagctggaccgttgcacggcctggctaatcaggaagtgttgttgtggatcaaatct
gtaataggtgagactggtagtgacgttacaactgatcaactcaaagagtatgtgtggaag
acactaaaaagtggaaaggttgttcctggctttggtcatggagttctacgtaagaccgat
ccacggtatacatgtcagagggagtttgctttgaagtacttgcctgaggatccacttttc
caactggtctccaagttgtatgaagttgtgcctcctatcctcactgagcttggcaaggtc
aaaaacccatggcctaatgttgatgctcacagcggagttctactgaaccactttggatta
tctgaagctcggtattacactgttcttttcggagtttcaaggagcattggaataggatct
cagctcatttgggaccgtgctcttggcctgccgctcgaaagaccgaagagtgtcaccatg
gagtggctggagaaccactgcaagaaggttgctgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328812
Entry
4328812           CDS       T01015                                 
Name
(RefSeq) citrate synthase 3, peroxisomal
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
osa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4328812
   00630 Glyoxylate and dicarboxylate metabolism
    4328812
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     4328812
SSDB
Motif
Pfam: Citrate_synt DUF1347
Other DBs
NCBI-GeneID: 4328812
NCBI-ProteinID: XP_015626660
UniProt: Q6EUF8 A0A0P0VGV1
LinkDB
Position
2:7491170..7497698
AA seq 500 aa
MDRARLAVLSAHLASPAAACGEADAAGPLERSAASAGARGGALAVVDGRTGKRYEVKVSD
EGTVRATDFKKITTGKDDKGLKIYDPGYLNTAPVRSSICYIDGDEGILRYRGYPIEELAE
SSSFVEVAYLLMYGSLPTQSQLAGWEFAISQHSAVPQGLLDIIQAMPHDAHPMGALASAM
STLSVFHPDANPALRGQDLYKSKQVRDKQIVRVLGKAPTIAAAAYLRLAGRPPILPTNSL
SYSENFLYMLDSLGDKEYKPNPRLARVLDILFILHAEHEMNCSTAAARHLASSGVDVFTA
LSGAVGALYGPLHGGANEAVLKMLNEIGSVENIPDFIEGVKNRKRKMSGFGHRVYKNYDP
RAKVIRKLAEEVFSIVGRDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGF
PTEFFPVLFAIPRMAGWLAHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERVPASQGE
QLGQIATSNATRRRRAGSAL
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggatcgcgcccgcctcgccgtgctctccgcccacctcgcctcccccgccgccgcctgc
ggggaggcggacgcggcggggccgctggagaggtcggcggcgtctgcgggggcgcgaggc
ggcgcgctggcggtggtggatgggaggacggggaagaggtacgaggtcaaggtgtcggac
gaggggaccgtgcgcgccaccgacttcaagaagattaccactggaaaggacgacaagggt
cttaagatctatgatcctggttatctcaacacagccccagttcgctcatccatctgctac
attgatggggatgagggaattcttcgttacaggggatacccaattgaagagttggctgaa
agcagctcatttgttgaggtggcctacctcctgatgtacggaagtttgcctacccagagc
caattggctggatgggaatttgcgatttctcagcactctgctgttccccagggactcttg
gatatcatacaagcaatgcctcatgacgctcatcccatgggtgcccttgccagtgcaatg
agcacgctttctgtcttccatccggatgcaaaccctgctcttagaggtcaagatctttac
aagtcgaagcaggttagggataagcagattgtgcgagtacttgggaaggcaccaacaatt
gcagctgcagcgtacttgagattagctggaagacctcctatccttcctacaaatagtctc
tcttattcagagaacttcttgtatatgctagactctttgggtgacaaagaatacaagcca
aatcctagacttgctagggttctagatatcctttttattctccatgctgaacatgaaatg
aactgctctacagctgctgctaggcaccttgcttcaagtggtgttgatgtcttcactgct
ctttctggtgctgttggagctctatatggtccactgcatggtggtgcaaatgaggcggta
cttaaaatgttaaatgaaattggaagtgtggagaatattccagatttcatcgagggagtg
aaaaacaggaagagaaagatgtcaggttttgggcaccgtgtttacaagaattatgatccc
cgtgctaaagtcatccgaaagctagcagaggaggtcttctctattgtcggacgggatcct
cttatcgaggttgctgttgcgttggagaaggcagcattgtcagatgattattttgtcaag
aggaagctgtatccaaatgtggatttttactctggcttaatatatagggcaatgggattc
cctacagagttcttccctgttctgtttgcaattcctcgcatggctggttggttagcacat
tggaaagagtcacttgatgatccagacactaagattatgaggcctcagcaggtatacact
ggtgtttggctgaggcattacacacctgtcagagaacgagtcccagcaagccagggcgaa
cagcttggtcagattgctacctctaacgcaacaaggcgtcggcgtgcaggttctgccctg
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350660
Entry
4350660           CDS       T01015                                 
Name
(RefSeq) citrate synthase 4, mitochondrial
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
osa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4350660
   00630 Glyoxylate and dicarboxylate metabolism
    4350660
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     4350660
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-GeneID: 4350660
NCBI-ProteinID: XP_015618050
UniProt: Q2R339 A0A8J8Y6I9
LinkDB
Position
11:19649312..19655823
AA seq 472 aa
MAFFRGLTAVSRIRSRMAQEATTLGGVRWLQMQSPSDLDLKSQLQELIPEQQDRLKKLKS
EHGKVQLGNITVDMVLGGMRGMIGMLWETSLLDPEEGIRFRGLSIPECQKVLPTAIKGGE
PLPEGLLWLLLTGKVPTKEQVDALSKELVTRSSVPGHVYKAIDALPVTAHPMTQFTTGVM
ALQVESEFQKAYDKGMPKSKFWEPTYEDCLNLIARLPPVASYVYRRIFKDGKTIAADNAL
DYAANFSHMLGFDDPKMLELMRLYVTIHTDHEGGNVSAHTGHLVGSALSDPYLSFAAALN
GLAGPLHGLANQEVLLWIKSVIGETGSDVTTDQLKEYVWKTLKSGKVVPGFGHGVLRKTD
PRYTCQREFALKYLPEDPLFQLVSKLYEVVPPILTELGKVKNPWPNVDAHSGVLLNHFGL
SEARYYTVLFGVSRSIGIGSQLIWDRALGLPLERPKSVTMEWLENHCKKAAA
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcgttcttccggggcctgaccgcggtttcgaggattcgatcccgcatggcacaggag
gccaccacgcttggtggtgtgagatggctgcagatgcagagtccatctgatcttgatctt
aagtcccagctgcaggaattgattcccgagcaacaggatcgcttaaagaaacttaaatca
gaacatgggaaggtccagcttggaaacataactgttgatatggtccttggcgggatgaga
ggaatgattggaatgctttgggaaacatcattgcttgacccggaggagggtattcgtttc
aggggtctctcgattccagagtgccagaaagtgctgccaacagcaattaaaggtggagaa
cctttgccggagggtctcctttggcttcttttgactggaaaggtgccaaccaaagagcaa
gtcgatgctctatcaaaggaattggttacccgttcgagtgttccaggccatgtgtataag
gcaattgatgctctccctgtaactgctcatccaatgacacagtttaccacaggggtgatg
gcacttcaagttgagagtgagtttcaaaaagcttacgacaaaggaatgccaaaatcaaag
ttctgggagcctacctatgaagattgcttaaatttgatagctcgccttccaccagtggct
tcgtatgtttaccggaggatcttcaaggatgggaaaactatagcagctgataatgcactg
gactatgcagcaaacttttcacacatgcttgggtttgatgatcccaaaatgctcgagttg
atgcgactatatgtgacaatccacactgatcatgaaggtggaaatgtcagtgctcatact
ggacatctggttggaagtgctctgtcagatccttatctttcttttgcagctgcactgaat
ggtttagctggaccattgcacggcctggctaatcaggaagtgctgttgtggatcaaatct
gtaataggtgagacaggtagtgatgttacaactgatcaactcaaagagtatgtgtggaag
acactaaaaagtggaaaggttgttcctggcttcggtcatggagttctacgtaagaccgat
ccacgatatacatgtcagagggagtttgctttgaagtacttgcctgaggatccacttttc
caactggtctccaagttgtatgaagttgtgcctccaatcctcactgagcttggcaaggtc
aaaaacccatggcctaatgttgatgctcacagtggagttctgctgaaccactttggatta
tctgaagctcggtattacaccgtccttttcggagtttcgaggagcataggcataggatcc
cagctcatttgggaccgtgctcttggtctgccgctcgaaagaccgaagagtgtcaccatg
gagtggctggaaaaccactgcaagaaggctgctgcttga

DBGET integrated database retrieval system