KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328635
Entry
4328635           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4328635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4328635
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4328635
  Bacteria
    4328635
SSDB
Motif
Pfam: Ribosomal_L12
Other DBs
NCBI-GeneID: 4328635
NCBI-ProteinID: XP_015627660
UniProt: A0A0P0VG26 Q6H730
LinkDB
Position
2:complement(5550088..5552121)
AA seq 193 aa
MSLSTIARRLCCSRPTSGGRLSAVWAHLYSTEAAKDTGAKKYKYPEVYDPYGPMSPPSQK
VVDLADRIAALPPEEIKQIAPALLLRLNQPPPQAISGQGFSFSPQGGGGAAGAAKAEEKK
AEKTVFDVKLEKFDAAAKIKIIKEIRTFTDLGLKEAKELVEKAPVILKQSLTKEEAEAII
EKIKVAGGVAVME
NT seq 582 nt   +upstreamnt  +downstreamnt
atgagtctctctaccatagcaagacgactatgttgttcaagaccaacatctgggggtcgt
ctttcagcggtttgggctcatttgtacagcacagaggctgccaaagacacaggtgctaag
aagtataaataccctgaagtctatgatccatacgggcctatgtcacctccatcgcagaaa
gttgtggatcttgctgatcgcattgctgccctccctcctgaggagatcaaacagattgct
ccggctctccttctcagactgaaccaacccccaccacaggcaatttctggacagggtttc
agtttcagtcctcaaggtggtggcggtgctgctggtgctgcaaaggcagaggagaagaaa
gcagagaaaacagtctttgacgtcaagctggagaaatttgacgctgctgctaaaattaag
atcatcaaggagattagaacattcacagatttggggctgaaggaggcgaaggagctagtg
gagaaggcccctgtcattctgaagcagtcactcacgaaggaggaagctgaggcaatcata
gagaagattaaggtagctggcggtgtcgctgtgatggagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334016
Entry
4334016           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334016
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334016
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4334016
  Bacteria
    4334016
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N
Other DBs
NCBI-GeneID: 4334016
NCBI-ProteinID: XP_015632316
UniProt: A0A0P0W2S0 Q6AVT7
LinkDB
Position
3:complement(30080562..30081503)
AA seq 175 aa
MASRLLHLRRLLPSARPSAGGGGGGGGAVAAFSTVTPTPRVSALVDEICGLTLIEASSLT
DALRGRLGVDQLPPLAILTGGAAPLAGGGAATGAAGEEAKAKEEKMAFDVKLEGFDAAAK
LKIIKELRAFTNLGLKEAKELVEKAPAVLKAGVPKEEAESIAEKMRAIGAKIVLE
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcttcccgcctcctccacctccgccgcctcctcccctccgcccgcccgtccgccggc
ggcggcggcggcggcggcggtgcggtcgccgccttctcaaccgtaaccccgaccccgcgc
gtctccgcgctcgtagacgagatctgcggcctcaccctcatcgaggcctcctccctcacc
gacgccctccgcggccgcctcggcgtcgaccagctccctccgctggccatcctcaccggc
ggcgcggccccgctcgctggcggcggggcggccaccggggcggccggcgaggaggcgaag
gcgaaggaggagaagatggcgttcgacgtgaagctggagggcttcgacgccgccgcgaag
ctcaagatcatcaaagagctgagggcgttcacgaatctgggcctcaaggaggcgaaggag
ctcgtggagaaggcgccggccgtgctgaaggcgggagtccccaaggaggaggcggagagc
atcgccgagaagatgcgagctattggcgccaagattgttctcgaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339552
Entry
4339552           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339552
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339552
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4339552
  Bacteria
    4339552
SSDB
Motif
Pfam: Ribosomal_L12
Other DBs
NCBI-GeneID: 4339552
NCBI-ProteinID: XP_015640018
UniProt: B9FHV8 Q6I629
LinkDB
Position
5:complement(27546064..27548801)
AA seq 198 aa
MAASLLRSGHRLRLLRHGSLSWASFSAAAAEELIDVRKLPTDYDASTFDPTAPSRPPPSD
RVWRLVEDVSSLTLAESAALSALLLRRLDVPAPPIAILNSAAGLGGGGGAGAAGAAGEKA
GGAAAAEKTVFELRLEAFDAASKIKVIKEIRSFTDLGLKEAKELVEKAPAVIKGGVSKEE
ARTIIDKMKAVGAKVVMD
NT seq 597 nt   +upstreamnt  +downstreamnt
atggccgcctcgctcctccgctccggccaccgcctccgcctcctccgccacggcagcctc
tcctgggcctccttctccgccgccgccgcggaggagctcatcgacgtccgcaagctcccc
actgactacgacgcctccaccttcgaccccaccgccccgtcccgcccaccgccctccgac
cgcgtctggcgcctcgtcgaggacgtctcctccctcaccctcgccgagtccgccgctctc
tccgccctcctcctccgccgcctcgacgtccccgctccccccatcgccatcctcaactcc
gccgcgggcctcggcggcggcggcggcgcgggtgccgcgggcgccgccggggagaaggcc
ggtggggcggcggcggctgagaagacggtgttcgagctgcgcttggaggcgttcgatgcg
gcgagcaagatcaaggtgatcaaggagatccggtcattcaccgacctgggtctgaaggag
gcgaaggagctagtggagaaggcacccgctgtgatcaagggtggtgtctcgaaggaggag
gctcggacaatcatcgataagatgaaggctgttggtgccaaggtcgtcatggactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339648
Entry
4339648           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L12, chloroplastic-like
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339648
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339648
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4339648
  Bacteria
    4339648
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N
Other DBs
NCBI-GeneID: 4339648
NCBI-ProteinID: XP_015638705
UniProt: Q9ZWF5 Q0DFV2
LinkDB
Position
5:complement(28299318..28300137)
AA seq 179 aa
MAMASTAVSSTLPLFHVRTASSAPAALRFTTRGRGGGRHSVACNSTAASSPKVLELGDAI
AGLTLEEARGLVDHLQERLGVSAAAFAPAAVVAAPGAAGGGEDGAPAEKTEFDVVIEEVP
SSARIATIKVVRALTNLALKEAKDLIEGLPKKAKEAVSKEEAEEAKKQLEEVGAKVSIA
NT seq 540 nt   +upstreamnt  +downstreamnt
atggccatggcttccaccgccgtctcctccaccctacccctcttccacgtccgcaccgcc
tcctccgctcccgcggcgctccggttcaccacccgcggccgcggcggcggccgccactcc
gtcgcctgcaactccacggcggcttcttcccccaaggtgctcgagctcggggacgccatc
gcggggctcaccctggaggaggccaggggcctcgtggaccacctccaggagcgcctcggc
gtgtccgcggccgcgttcgcgcccgccgcggtcgtcgcggcgcccggcgccgcgggcggc
ggcgaggacggcgcgcccgccgagaagacggagttcgacgtggtgatcgaggaggtgccg
agcagcgcgcgcatcgcgaccatcaaggtggtgcgcgcgctgacgaacctggcgctcaag
gaggccaaggacctcatcgagggtctccccaagaaggccaaggaggccgtgagcaaggag
gaggccgaggaggccaagaagcagctcgaggaggtcggcgccaaggtgtcaatcgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343966
Entry
4343966           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343966
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343966
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4343966
  Bacteria
    4343966
SSDB
Motif
Pfam: Ribosomal_L12
Other DBs
NCBI-GeneID: 4343966
NCBI-ProteinID: XP_015645273
UniProt: A3BMD9 Q8LI41
LinkDB
Position
7:complement(25930334..25931367)
AA seq 167 aa
MPLFASKFAPLIPRLRRLSTAAAAATATAAGEDPKLSRIADQLLELSPAELDDYSALLRL
KLRLSLTSSAASGAAATGAAGDAASGSAGAEEAAAVKTSFDVKIEKYEAAAKIKIIKEVR
AVTDLGLKEAKELVEKAPVVVRSGLPKEEAEALAAKLKAAGAAVALE
NT seq 504 nt   +upstreamnt  +downstreamnt
atgccactcttcgcttccaaattcgcgccgctgatcccccggctccgccgcctctccacc
gcggcggcggcggcgacggcgacggccgccggggaggacccgaagctgtcgcgcatagcg
gaccagctcctggaactctcccctgccgagctcgacgactactcggcgctcctgcggctc
aagctccgcctctcgctcacgtcgagcgccgcatcgggggccgcggccactggcgcggcc
ggagacgccgcctccggctccgccggcgcggaggaggccgcggcggtgaagacgtcgttc
gatgtcaagatcgagaagtacgaggcggcggcgaagataaagatcatcaaggaggtgcgc
gcggtgacggacctggggctgaaggaggcgaaggagctcgtggagaaggcgccggtcgtg
gtgcgatccgggcttcccaaggaggaggccgaggcgctcgccgccaagctcaaggccgcc
ggcgccgccgtcgcgctcgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271252
Entry
9271252           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L12, chloroplastic
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9271252
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9271252
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    9271252
  Bacteria
    9271252
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N
Other DBs
NCBI-GeneID: 9271252
NCBI-ProteinID: XP_015624137
UniProt: O22386
LinkDB
Position
1:27041771..27044158
AA seq 185 aa
MASTALSSAFSLLSLPSSSSPAAAAAAAPRSFAVPSRARPRRAVAVVASTATESPKVLEL
GDAIAGLTLEEARGLVDHLQERLGVSAAAFAPAAVVAAPGAGGAGAAADEAPAEKTEFDV
VIEEVPSSARIASIKVVRALTNLALKEAKDLIEGLPKKVKEGVSKDEAEDAKKQLEEVGA
KVSIA
NT seq 558 nt   +upstreamnt  +downstreamnt
atggcttccaccgcgctctcctccgccttctccctcctctccctcccctcctcctcctcc
cccgccgccgccgccgccgccgccccaaggtccttcgccgtccccagccgcgcccgccca
cgccgcgccgtcgccgtggtggcgtccaccgccaccgagtcccccaaggtcctggagctc
ggggacgccatcgcggggctcaccctcgaggaggcgcggggcctcgtggaccacctccag
gagcgcctcggcgtctccgccgccgccttcgcgcccgccgccgtcgtcgccgcgcccggc
gcgggcggcgcgggcgccgccgccgacgaggcccccgccgagaagacggagttcgacgtg
gtcatcgaggaggttcccagcagcgcgcgcatcgccagcatcaaggtggtgcgcgcgctc
accaacctggccctcaaggaggccaaggacctcatcgagggcctccccaagaaggtcaag
gagggtgtcagcaaggacgaggccgaggatgccaagaagcagctcgaggaggtcggcgcc
aaggtgtccattgcgtga

DBGET integrated database retrieval system