KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328642
Entry
4328642           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit S10B homolog B
  KO
K03064  26S proteasome regulatory subunit T4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4328642
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4328642
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4328642
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 RuvB_N AAA_2 AAA_5 AAA_22 DUF815 AAA_18 AAA_7 TIP49 Prot_ATP_OB_N Mg_chelatase RNA_helicase Sec8_exocyst AAA_33 Sigma54_activat AAA_14 AAA_3 Parvo_NS1 AAA_24 TsaE NACHT bpMoxR ATPase IstB_IS21 AAA_28 AAA_25 ATPase_2 ABC_tran PhoH AAA_30
Other DBs
NCBI-GeneID: 4328642
NCBI-ProteinID: XP_015624666
UniProt: Q9FXT8 Q6H718
LinkDB
Position
2:complement(5595407..5600890)
AA seq 400 aa
MADGEDAAAARRRASVTEYRKKLLNCRELESRVSTVRENLKNAKKDFTKTEDDLKSLQSV
GQIIGEVLRPLDNERFIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRTLPR
EVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPELFLRVGIKPPKGVLLY
GPPGTGKTLLARAIASNIDANFLKIVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMD
EIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDELGKVKMIMATNRPDVLDPALLRPG
RLDRKIEIPLPNEQARMEVLKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMA
AIRAERDYVVHEDFMKAVRKLNDAKKLESSAHYSADFGKE
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggccgacggggaggacgccgccgccgcccgccgccgcgcctccgtgacggagtaccgg
aagaagctgctcaactgcagggagctcgagtcgcgcgtcagcaccgtgagggaaaaccta
aaaaatgctaagaaggactttacaaagaccgaagatgacttaaaatccctgcaaagtgtt
gggcagatcatcggagaggttctccgccctcttgataatgaacgttttattgttaaggct
agcagtggtcccagatatgtggttggttgccggagcaaagtggacaaggagaaattgact
tcgggaactcgtgttgttcttgacatgacaacactgacaatcatgcgcacacttccacgt
gaggtggaccctgtggtttacaacatgcttcatgaagaccctggtaatgtcagttactct
gctgttggtggtctgtctgatcagattagagagctcagggagtccatcgaattgccctta
atgaaccctgagctctttcttcgtgttgggatcaagccccccaagggtgttctactctat
ggtccaccaggaactggtaagacactattggcgagggctattgccagtaacatcgatgcc
aactttttgaagattgtttcaagtgctataattgacaagtacattggagagagtgcccgc
ttgattagggaaatgtttggctatgcacgtgatcatcaaccatgcataatcttcatggac
gaaatcgatgccattggtgggcggcggttcagtgaaggaactagtgctgatcgcgagatc
cagcgcacactgatggaactgctaaatcagttagatggatttgatgaacttggaaaggtg
aaaatgatcatggctaccaatagacctgatgttctggaccctgcgctactgcgtcctgga
cgtctagacaggaagattgagattccgctaccaaatgagcaagcaagaatggaagttctt
aaaatccatgctgctggtattgccaagcatggagaaattgattatgaggcagttgttaaa
ctggctgagggcttcaatggggctgatcttcgcaacgtctgcactgaagcgggtatggct
gcaattcgtgctgaacgggactacgttgtccatgaggacttcatgaaggctgtcaggaag
ctgaacgacgccaagaagctggaatccagcgcccactacagtgcagacttcggcaaagag
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341487
Entry
4341487           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit S10B homolog B
  KO
K03064  26S proteasome regulatory subunit T4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4341487
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4341487
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4341487
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 RuvB_N AAA_5 AAA_2 AAA_22 AAA_18 DUF815 AAA_7 TIP49 AAA_14 Mg_chelatase RNA_helicase AAA_3 Prot_ATP_OB_N Parvo_NS1 IstB_IS21 AAA_24 TsaE NACHT Sigma54_activat AAA_33 bpMoxR AAA_28 ATPase_2 ATPase ABC_tran PhoH AAA_25
Other DBs
NCBI-GeneID: 4341487
NCBI-ProteinID: XP_015641387
UniProt: A3BDF5 Q69Q32
LinkDB
Position
6:24182511..24186485
AA seq 401 aa
MAAEGEDAAAARRRAAATDYRKKLLTCRELEARARTARDNLKNAKKDFGKTEDDLKSLQS
VGQIIGEVLRPLDSERFIVKASSGPRYVVGCRSKVDKEKLIAGTRVVLDMTTLTIMRTLP
REVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPKLFLRVGIKPPKGVLL
YGPPGTGKTLLARAIASNIDANFLKIVSSAIIDKYIGESARLIREMFSYAREHQPCIIFM
DEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDELGKVKMIMATNRPDVLDPALLRP
GRLDRKIEIPLPNEQSRMEVLKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGM
AAIRAERDYVIHEDFMKAVRKLNDAKKLESSAHYSADFGKE
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcggcggagggggaggacgcggcggccgcgcgacgccgcgcggcggccaccgactac
aggaagaagctcctcacctgcagggagctcgaggcgcgcgcccgcacggcaagggacaac
ctgaaaaatgcaaagaaagattttgggaaaaccgaggatgacttgaagtcattgcaaagt
gtaggccaaataattggtgaagtacttcgaccattggatagtgaacgattcatcgtcaaa
gccagcagtgggccccgctatgttgttggctgccgaagtaaagttgacaaagaaaagttg
attgctggaacgagggttgttcttgacatgacaacccttaccatcatgcgcacactgcca
cgagaggttgatccagtggtatataacatgctacatgaagaccctggcaacgtcagttac
tcagctgtgggtggattgtcggatcaaataagggaacttagggagtccattgaacttccc
ctgatgaatccaaaattgtttcttcgtgtagggattaaaccgccaaagggtgttctgctc
tatggtccacctggaactgggaagacactacttgctagagctattgccagtaacattgat
gcaaactttttaaagattgtgtcaagtgctatcattgacaagtacataggtgaaagtgca
cgtctcataagagagatgttttcctatgcacgggagcatcaaccatgcatcattttcatg
gatgaaattgatgccatcggtggccgaaggttcagtgaaggaaccagtgctgaccgggaa
attcagagaacactaatggagctcttaaaccagttagatggatttgatgagcttggaaag
gtaaaaatgatcatggcgactaatcgtcctgatgttttggaccctgcactccttcgtcct
gggcggttggacaggaagattgaaattccactgccaaatgagcagtcgaggatggaagtc
ctcaaaattcacgcagctggtattgctaaacatggtgaaatcgattatgaagctgtcgtg
aagctagctgaaggcttcaatggtgccgatctgcgcaatgtctgcactgaggctggcatg
gctgctattcgagcagagcgcgactatgtcattcatgaagatttcatgaaggcggtgcgc
aagctgaacgacgccaagaagctcgagtctagtgcgcactacagcgcggactttggcaag
gaatga

DBGET integrated database retrieval system