KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328674
Entry
4328674           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit 8 homolog A
  KO
K03066  26S proteasome regulatory subunit T6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4328674
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4328674
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4328674
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_16 AAA_5 RuvB_N AAA_22 TIP49 AAA_33 AAA_18 AAA_3 AAA_24 Mg_chelatase ATPase DUF5906 PhoH RNA_helicase AAA_28 IstB_IS21 DUF815 AAA_14 AAA_7 Sigma54_activat TsaE AAA_25 bpMoxR AAA_17 HR1 AAA_11 Parvo_NS1 APG6_N Zeta_toxin AAA_19 ABC_tran DUF2072
Other DBs
NCBI-GeneID: 4328674
NCBI-ProteinID: XP_015626915
UniProt: Q7GCH3 Q6Z6C9
LinkDB
Position
2:complement(5918985..5923663)
AA seq 424 aa
MATVAMDISKPPPAAGGDEAAAAKGRGGAGGGGGEGLRQYYLQHIHDLQLQIRQKTHNLN
RLEAQRNDLNSRVRMLREELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSI
DITKITPSTRVALRNDSYMLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKE
VIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKY
IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELLNQLDG
FEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMNLMRGI
DLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKNMSLR
KLWK
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggccacggtggcgatggacatctccaagccccctcccgcggcgggcggcgacgaggct
gcggcggcgaaggggaggggcggcgccggaggaggaggtggggaggggctgcggcagtac
tacctgcagcacatccacgacctgcagctccagatccggcagaagacgcacaacctcaac
cgcctcgaggcccagcgcaacgacctcaactcccgagttagaatgctcagggaagagctg
cagttgcttcaagaacctggctcgtatgttggtgaggtggtgaaggtcatgggtaaatca
aaggttctagtgaaggtacatccagaaggcaaatatgtggtggatattgataaaagcatt
gatattacaaagatcacaccttcaacaagagttgctcttcgaaatgatagctatatgctt
catttgatcctgccaagcaaagttgatccgttggtcaatcttatgaaagttgagaaggtt
cctgattctacttatgatatgattggaggtcttgatcagcaaatcaaagagatcaaagag
gtcattgaacttcctatcaaacatccagagctatttgagagtcttggaattgcccaacca
aagggtgtccttctctatggccctccaggcacaggaaaaacattgttggcacgtgcagtt
gctcatcacactgactgcaccttcatcagggtgtctggttccgagttagttcagaagtac
attggtgagggttctcggatggtccgtgaactctttgttatggccagggaacatgcacca
tccattattttcatggatgaaatagactccattggatctgctaggatggagtctggaact
ggcaacggtgacagtgaagtccagcgaaccatgcttgagcttctgaaccaacttgatggt
tttgaagcatcaaacaaaataaaggttctgatggcaacaaataggatagacatcttggat
caggcccttctgaggcctggtcgcatagacaggaaaattgaatttcctaatcctaatgag
gattcacgctttgatatcttgaagattcattcaagaaaaatgaacttgatgcgtggtatt
gatctgaaaaagatcgctgaaaagatgaatggggcttcaggagccgagctcaaggcggtc
tgcacagaagctggaatgtttgctcttcgtgagagaagggtgcatgtaacacaagaggac
tttgagatggcagtggcgaaggtgatgaagaaagacacggaaaagaacatgtccctacgg
aagctctggaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341448
Entry
4341448           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit 8 homolog A
  KO
K03066  26S proteasome regulatory subunit T6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4341448
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4341448
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4341448
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_5 AAA_16 RuvB_N AAA_22 AAA_33 TIP49 DUF5906 AAA_18 AAA_3 Mg_chelatase ATPase AAA_28 RNA_helicase DUF815 IstB_IS21 AAA_14 AAA_24 Sigma54_activat AAA_7 TsaE PhoH bpMoxR Parvo_NS1 AAA_17 AAA_25 TMF_TATA_bd Zeta_toxin AAA_19
Other DBs
NCBI-GeneID: 4341448
NCBI-ProteinID: XP_015641117
UniProt: A0A0P0WYS6 Q69X47
LinkDB
Position
6:23685171..23688265
AA seq 423 aa
MATADVSRPSSSAPTAAAAGADGHGAKGSAFRGDGLRPYYQSRIHDLQLQIRQGTDNLSR
LEAQRNVLNSQVITLGEELKVLHEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDVDKSID
ITKLSPSTRVALRNDSYMLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEV
IELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYI
GEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMQSGSGGGDSEVQRTMLELLNQLDGF
EASNKIKVLMATNRMDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMNLMRGID
LKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVNQEDFLMAVAKVMKKDTEKNMSLRK
LWK
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggcgacggcggacgtctcgcggccctcctcctccgcgccgacggcggcggctgcgggg
gcagacggccacggggcgaaggggagcgccttccgcggcgacgggctgcggccgtactac
cagtcgcgcatccacgacctgcagctccagatccgccaagggacggacaacctcagccgc
ctcgaggcccagcggaacgtcctcaattcccaagttataacgctgggggaagagttgaag
gtgctccatgaaccgggctcatatgttggtgaggttgtcaaggttatgggcaagtccaag
gttctagtgaaggtgcacccagaaggaaaatatgttgttgatgtcgataaaagtattgat
attacaaagctctcgccttcaacaagagttgctcttcgaaatgacagctatatgcttcat
cttatcctgcccagcaaagttgatccattggttaatcttatgaaggttgagaaggttcct
gattctacttatgatatgattggcggccttgatcagcagattaaggagatcaaagaggtt
attgagcttcccattaagcatcctgagctgtttgaaagtcttggaattgcccagccaaag
ggtgtccttctttacgggcctccgggtacaggaaaaacgctactagctcgggcagttgct
catcacaccgactgtacctttattagggtgtcaggttccgagttggttcagaagtatatt
ggagagggttccagaatggttcgtgaactatttgtgatggccagagagcatgcaccatcc
ataatctttatggatgaaatagactccattggatctgctagaatgcagtcaggatctggg
ggtggtgatagtgaggttcaacgcactatgcttgagcttctgaatcaacttgatggcttt
gaagcatcaaacaaaattaaggttcttatggcgacaaataggatggatattttggatcaa
gctctcctgaggcctggtcgcattgataggaagattgaatttccaaatccgaatgaagat
tcccgctttgatatcttgaagattcattcaagaaaaatgaacttgatgcgtggcattgat
ctgaaaaagattgcagagaagatgaatggggcatctggagcagagcttaaggcggtctgc
acggaagcaggaatgtttgcccttcgcgagagaagggttcatgtcaaccaggaggatttc
ttgatggcggtggcgaaggtgatgaagaaggataccgaaaagaacatgtccctgcgcaag
ctctggaagtga

DBGET integrated database retrieval system