KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328823
Entry
4328823           CDS       T01015                                 
Name
(RefSeq) U2 small nuclear ribonucleoprotein A'
  KO
K11092  U2 small nuclear ribonucleoprotein A'
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328823
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4328823
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4328823
 Complex B
    4328823
 Complex C
   U2 SnRNP specific factors
    4328823
SSDB
Motif
Pfam: LRR_9 LRR_4 LRR_8
Other DBs
NCBI-GeneID: 4328823
NCBI-ProteinID: XP_015627328
UniProt: Q6EUK2 B9F4G6
LinkDB
Position
2:complement(7630851..7635237)
AA seq 284 aa
MVRLTADLIWKSPHFFNAVKDRELDIRGNKIPIIENLGATEDQFDTIDLSDNEIVKLENF
PYLNRLGTLLVNNNRITRINPNLGEFLPKLHTLVLTNNRLTNLAEIDPLASLPKLQFLSL
LDNTVTKQPDYRLYVIHKLKHLRLLDFKKVKQQERIAAAQKFHSKEAEEEAKKVPAKTFT
PGQVVDAQDTTMEEQGPKVVAPTPEQITAIKAAIVNSQTLEEVARLEKALSTGQIPAEFA
IPKPDANMADASEETEKMETDGQNQENGADEKKQNEESTPIEED
NT seq 855 nt   +upstreamnt  +downstreamnt
atggtgaggctcaccgccgacctgatatggaagagcccgcacttcttcaacgccgtcaag
gaccgcgagctcgacatccgaggtaacaagatccccatcatcgagaatctgggcgccacc
gaggaccaatttgacacaattgacttgtcagacaatgagattgtcaagcttgagaacttc
ccgtacttgaatcgtcttggcactctgttagttaacaataacagaatcacacgtatcaat
cccaatcttggtgagttcttgccaaagttacatacattggtgcttacaaacaatcgtctt
acaaatcttgcggagatcgatcccctggcatctcttccaaagcttcagtttcttagctta
cttgataatactgtaaccaagcagccagactaccggttgtatgtgatccataaattgaag
catttgcggttgctggatttcaagaaagtgaaacaacaggagagaattgcagcagcacag
aagtttcactcaaaggaggcagaggaagaggcaaagaaggtgccagccaaaacttttact
cctggacaggtggtggatgctcaagataccacaatggaggagcagggtccaaaagtagtt
gctccaacacctgagcaaatcacagctatcaaggctgccattgtgaattctcagacactt
gaggaggttgcaaggcttgaaaaggcactgagcactggccaaattcctgctgaatttgca
atccccaagccagatgctaatatggctgatgcttcagaggaaactgaaaagatggagaca
gatggtcagaaccaagaaaatggggcggatgagaagaagcaaaatgaagaaagcacccca
attgaagaggattga

DBGET integrated database retrieval system