KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328958
Entry
4328958           CDS       T01015                                 
Name
(RefSeq) U1 small nuclear ribonucleoprotein C-1
  KO
K11095  U1 small nuclear ribonucleoprotein C
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328958
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4328958
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    4328958
 Complex B
    4328958
SSDB
Motif
Pfam: zf-U1 CLIP1_ZNF
Other DBs
NCBI-GeneID: 4328958
NCBI-ProteinID: XP_015622805
UniProt: Q6ETX3 A3A5C2
LinkDB
Position
2:complement(9505845..9509900)
AA seq 228 aa
MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRTYYQQFEEQQTQSLIDQRIKEHLGQ
AAAFQVGAPFNQHLLSFPGGVPRPRLPILPTPGMPLGVPQVPGAPLMPGVRPPILPAPGI
PGYPGAPNVPTMPQTGAPPGSMPPGSMPPGSMPMQMAPLPRPPTLPPPTSGAPGAPIPNS
GAPPAMYQTNPPQPAGPTSGAPPPVSAPPPAAPPQAPFSYAQPPEGNH
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcctcggtactattgcgactactgcgacacctacctgacccatgactctccatctgtc
cgtaaacagcacaatgctgggtacaaacataaggcaaatgttcgaacctactatcaacaa
tttgaggagcagcaaactcaaagcttgattgatcaaagaattaaagaacatcttggacaa
gctgcagctttccaagttggtgctcctttcaatcaacatcttctctcatttccaggaggt
gtgcctcgtcctcgtcttccaattctgccaacacctggcatgccacttggtgttcctcaa
gtacctggtgcacctttgatgccaggcgttaggcctcctattttgccagctcctggtatt
ccaggttatcctggtgctccaaatgttccaaccatgccacaaacaggcgccccacctggt
tccatgccgcctggctctatgccacctggttctatgcctatgcagatggcacctctccca
aggcctccgacactaccacctccaacatctggagccccaggggcccccatccccaacagt
ggggcacctccagccatgtatcaaacaaatccaccgcaacctgcaggcccaacttctggt
gctccacctccggtttctgctccacctccagcagcacctccacaggctcctttctcctat
gcacaacctcctgagggcaaccactga

DBGET integrated database retrieval system