Oryza sativa japonica (Japanese rice): 4328975 Help Entry 4328975           CDS       T01015                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism osa  Oryza sativa japonica (Japanese rice) Pathway osa04145   Phagocytosis osa04517   IgSF CAM signaling osa04814   Motor proteins Brite KEGG Orthology (KO) [BR:osa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     4328975  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     4328975   09142 Cell motility    04814 Motor proteins     4328975  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:osa03037]     4328975    04812 Cytoskeleton proteins [BR:osa04812]     4328975 Cilium and associated proteins [BR:osa03037]  Motile cilia and associated proteins   Dynein arm    4328975 Cytoskeleton proteins [BR:osa04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      4328975 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  4328975 NCBI-ProteinID:  XP_015623481 UniProt:  Q0E258 LinkDB All DBs Position 2:join(9669072..9669209,9669339..9669500) Genome browser AA seq 99 aa AA seqDB search MLEGKARVEDTDMPARMQAAATSAASRALDLFDVADCRAIAGHIKAEFDKRYGVGWQCVV GANFGCFFTHTSGTFIYFSLERLSFLLFKAAAAAAIAAS NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgctggaggggaaggcgcgggtggaggacacggacatgccggcgcggatgcaggcggcg gccacgtccgcggcgtcgcgggcgctcgacctcttcgacgtcgccgactgccgcgccatc gccggacacatcaaggcggagttcgacaagaggtacggggtggggtggcaatgcgtggtg ggcgcaaacttcggctgcttcttcacccacaccagcggcaccttcatctacttctccctc gagcgcctctccttcctcctcttcaaggccgccgccgccgccgccatcgccgcctcctaa

DBGET integrated database retrieval system