KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329080
Entry
4329080           CDS       T01015                                 
Name
(RefSeq) sirohydrochlorin ferrochelatase isoform X1
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4329080
Enzymes [BR:osa01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     4329080
SSDB
Motif
Pfam: CbiX CbiK
Other DBs
NCBI-GeneID: 4329080
NCBI-ProteinID: XP_015623202
UniProt: Q6K5A7
LinkDB
Position
2:complement(11353281..11357735)
AA seq 212 aa
MHTISIPFQPLSATHTNKLTSWSIDVRNSASFVKLPRIGLNIGNIVMSAKPNSGFSSETA
QGESCTVGEKDGVIIVDHGSRREESNLMLNDFVAMFRARTGYKIVEPAHMELAEPTIKDA
FGKCVQQGASRVIVSPYFLSPGRHWKQDIPALAAEASKEHSNITYVVTAPLGLHELMVDV
MNDRIKYCLRHVAGNVEECTVCAGTGKCQLYP
NT seq 639 nt   +upstreamnt  +downstreamnt
atgcatactatctcaatccccttccaacccttaagtgcgacccatacaaacaaactgaca
tcatggagcattgatgtcaggaattctgctagctttgtcaagttgccgagaattggactc
aacattggaaacatagtcatgagtgccaagccgaattctggtttcagctcagaaacggcc
caaggagagagttgcaccgttggtgagaaggatggtgtgatcattgttgaccatgggtca
cggcgtgaagaatccaatctcatgctaaatgattttgttgccatgttcagggcgaggacc
ggttacaagatcgttgagcctgctcatatggagctagctgagcctactattaaagatgca
tttggaaaatgtgtgcaacaaggagcgtcccgtgttattgtcagtccatattttctttca
cctggacgacactggaaacaagatatccctgctttagctgcggaagcatctaaggagcac
tcaaacataacttatgttgtcactgcccctcttggattgcatgagcttatggtggatgtt
atgaatgatcgcatcaagtactgcctgagacacgttgcaggtaatgttgaggaatgtaca
gtatgtgctggaactggaaaatgccaactgtacccttga

DBGET integrated database retrieval system