KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329219
Entry
4329219           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4329219
  KO
K12275  translocation protein SEC62
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4329219
   04141 Protein processing in endoplasmic reticulum
    4329219
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4329219
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4329219
SSDB
Motif
Pfam: Sec62
Other DBs
NCBI-GeneID: 4329219
NCBI-ProteinID: XP_015627309
UniProt: A0A0P0VIH8 Q67U13
LinkDB
Position
2:complement(13840499..13848104)
AA seq 372 aa
MAGKGAKATAAKSAEKEKGKKAPVSRSSRAGSQEKPAPNKDVYQLFAEKVRDNKQLESRW
AIMQETRVEYFRGKDFTTFMRNHPEVREILGPDKDLEVEDIVNTLLSKNLVIRCDRVWKT
VRPGKKKLSSWPAHLEIHREQVFTENDGFFAWMFLKRRTLWQTILSFVWPLFALAVCLFP
VYPYQCKIVVLYSCAGALLFIVSILLLRAAIFGILWVLLGKRVWFFPNINAEETTFRELV
RFWPEKDEGERPKWTSRLFYATVAVLVILLLRHHAPDEAARARYQKKVSNIIDDVLEWSP
KLALSGMMEKHTGTNASETSNHTSGTGSSPVPPTNEGNTAKADPDMDRQTNSDKVQDGDE
YGDDMRTRFSEV
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcggggaagggagccaaggcgacggcggccaagtcggcggagaaggaaaaggggaag
aaggcccccgtatcccgctcatcccgcgccgggtcccaggagaagccagctccaaacaag
gatgtttaccaactatttgctgagaaggttagggataacaagcagctggaatcaagatgg
gcaattatgcaagaaactcgtgttgagtatttccgtggaaaagattttactaccttcatg
aggaatcatccagaagttagggaaattttagggccagataaagatttagaagtggaagac
attgttaacactctgctgagcaagaaccttgtgataaggtgtgaccgagtttggaaaact
gtcagaccaggaaagaagaaattgtcatcgtggcctgcacatttggagatacatcgtgaa
caagtgttcactgagaatgatggattttttgcttggatgtttctcaaaaggaggaccttg
tggcaaacgattctttcatttgtttggcctctctttgctttggcagtttgcttatttcca
gtttacccataccaatgcaagattgtggtcttgtactcatgtgctggagctttattgttc
attgtctctattcttttgttaagagctgctatctttggcatactatgggtactccttggg
aaacgtgtgtggttctttccaaatataaatgccgaagagacaacatttagagaacttgtt
cggttttggcccgagaaggatgagggagagcgaccaaagtggacatcaagactcttctat
gccactgttgctgtattggtgatattactgctcaggcaccatgctccagatgaagcagct
agggcaaggtaccagaagaaggtttcgaacataattgatgatgttcttgagtggtctcca
aagttagctttgtctgggatgatggaaaaacatactgggactaatgcatcagaaactagc
aatcacaccagtggaactgggagtagtcctgtccctcccactaatgaagggaataccgca
aaagcagacccagatatggatcgtcagacgaactcagataaagtccaagatggtgatgag
tatggtgatgacatgagaacaagatttagtgaagtttag

DBGET integrated database retrieval system