KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329409
Entry
4329409           CDS       T01015                                 
Name
(RefSeq) DNA repair protein RAD50 isoform X1
  KO
K10866  DNA repair protein RAD50 [EC:3.6.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
osa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4329409
   03450 Non-homologous end-joining
    4329409
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4329409
   03400 DNA repair and recombination proteins [BR:osa03400]
    4329409
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    4329409
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     4329409
    BRCA1-C complex
     4329409
   NHEJ (non-homologous end-joining)
    MRX complex
     4329409
SSDB
Motif
Pfam: AAA_23 SMC_N AAA_21 SbcC_Walker_B Rad50_zn_hook AAA_15 HAP1_N AAA_29 ABC_tran AAA_16 AAA_22
Other DBs
NCBI-GeneID: 4329409
NCBI-ProteinID: XP_015626780
UniProt: Q0E131 Q7Y239
LinkDB
Position
2:complement(17489929..17507814)
AA seq 1316 aa
MSTVDKMLIKGIRSFDPENKNVITFFKPLTLIVGPNGAGKTTIIECLKLSCTGELPPNSR
SGHTFVHDPKVAGETETKGQIKLRFKTAAGKDVVCIRSFQLTQKASKMEFKAIESVLQTI
NPHTGEKVCLSYRCADMDREIPALMGVSKAILENVIFVHQDESNWPLQDPSTLKKKFDDI
FSATRYTKALEVIKKLHKDQAQEIKTFRLKLENLQTLKDQAYRLRDNIAQDQEKSDALKI
QMEELRTNVQGVEDKIRRTEKSLADLRRLQQEINSSTSARTTYFTLQQQQYAALSEENED
TDDELKEWQTKFEERMALLQNKISKLERDVDDENTTSSFLSKAINDLMRETGRLQAEADA
HMSVKHERDSAIRKIFTKHNLGPIPDAPLTDAAAMHLTNITKAKLSNLNDDLQDKKKSNE
AQKQFLWGRYLEVNTRYSEVVGQIESKVASKKGISRRMKDKESERDAAEMDLSKYNLPRI
DEKERHLQIEVERKALALGERNYDSIVNQKRTEIFSLDQKIKTLQWEKDSIISDSNDRVL
LDVKKDELEESKKKLKKIFDEHKDKIRIVFKGRTPSEKEVKKELSQAFGSVDREYNDLNS
KSQEAAQELKLVQMKILDARSHLSKLQKELDAKRSYVESKLQSITKMSADINMFPKHLKD
AMDEREKQKNNLSYAKGMRQMYEPFENLARELHMCPCCQRAFTPDEEDEFVKKQRTTCES
TADRMNKISLECSNAEDFFQQLNKLNATYEEFVKLGKEAIPLAEKNLKQLLADESEKAQT
FDDFVSVLAQVKMDKDAVQVLLQPVETIDRHVQEIQQLGPQVENLEYKLDVRGQGVKSLE
QIQLELNSVQRTRDTLNNEVDDLRDQQRTLTDGLTNAQMRWHDIREEKLKASGAVHKFQK
AEEDLGHLAEEKEKLTLEEKHLEESLGPLSKERESLLQEHEALKEKLDQEYHQLAERKRE
FQQEIDALETHNERIKGYLNSKKGEKLNELQEKHTQLQSDLQKSKERKEEKSAELSKNKE
LLKSQDQLKRNIDDNLNYRRTKDEVERLTHEIELLEDKILSIGSLSTIEADLKQHSQEKD
RLLSEYNRCQGTQSVYQSNISKHKLELKQTQYKDIEKRYFNQLLQLKTTEMANKDLDRYY
AALDKALMRFHTMKMEEINKIIKELWQQTYRGQDIDYISINSDSEGAGTRSYSYRVVMQT
GDAELEMRGRCSAGQKVLASLIIRLALAETFCLNCGILALDEPTTNLDGPNAESLAGALL
RIMESRKGQENFQLIVITHDERFAQLIGQRQLAEKYYRVSKDEHQHSKIEAQEIFD
NT seq 3951 nt   +upstreamnt  +downstreamnt
atgagcacggtggacaagatgctgatcaaggggatccggagcttcgatccggagaacaag
aacgtcatcaccttcttcaagcccctcaccctcatcgttggccccaacggcgccggcaaa
accacgatcatcgagtgcctgaagctctcctgcaccggcgagctgcccccgaactcccgc
tccggccacaccttcgtgcacgaccccaaggtggcaggtgagacggaaacaaaagggcag
attaagctgcggtttaagacagcagcaggaaaggatgtggtgtgcatccgctccttccag
cttacccagaaggcatcaaaaatggagtttaaagcaattgagagcgtcctccagactata
aatccacacacgggcgagaaagtctgcctcagctacagatgtgctgatatggatagggag
attccagctttaatgggtgtatcaaaggctatactggagaatgttatattcgtgcaccaa
gatgagtccaattggcctttgcaggatccatcgacacttaagaagaagtttgacgatatc
ttttctgcgacccgctataccaaagctctcgaagtcataaaaaaacttcacaaggatcaa
gcacaggaaatcaagacttttaggttaaagttggagaaccttcagactctaaaagaccaa
gcatataggctccgtgacaatattgctcaagatcaagagaagtcagatgccttaaaaatt
caaatggaggaactgagaacaaacgttcaaggtgttgaagacaaaattcgtcgtactgaa
aaaagtttagctgacttgaggaggcttcaacaggaaattaactccagtacatctgctaga
actacatattttacacttcagcagcaacagtatgctgctctttctgaggaaaacgaagat
accgatgatgaactaaaggagtggcaaacgaaatttgaagaaagaatggcattgctgcaa
aataagatcagtaaactagaaagagatgtggatgatgaaaatacaacaagctccttcctt
tccaaggccataaatgatttgatgcgagaaacaggaaggctccaggcagaagctgacgct
cacatgtcagtgaaacacgaacgggattcagcaatcagaaagatcttcaccaaacataat
cttgggccaatacctgatgctcctttaactgatgctgctgccatgcaccttacaaacata
actaaagcaaaactgtcaaatcttaatgatgatttgcaggataagaagaaatctaatgag
gcacagaaacagtttctgtggggacgctatcttgaagtaaatactcgctactctgaagtt
gttggccagatagaatctaaggttgcctccaagaaaggtatttcaaggcgcatgaaagat
aaagagagtgaacgcgatgccgcggaaatggacctttcaaagtacaatcttccccgtatt
gatgaaaaggagagacatctgcaaattgaagttgaaaggaaagcacttgcgctgggagaa
aggaactatgattcaattgtaaatcagaagcgcacagagatatttagcttggaccagaag
ataaaaacacttcagtgggaaaaagacagcattattagtgattccaatgacagggtacta
ctagacgtgaagaaggatgaattggaagaaagcaagaagaaacttaaaaagatatttgat
gagcataaggacaaaatcagaattgtgtttaaagggaggactccttctgagaaggaagtc
aagaaggaacttagtcaagcctttgggtctgtagacagagaatacaatgatttgaactca
aaatcccaggaagcagcgcaagagctgaaactggtacagatgaaaatacttgatgctagg
agccacttgtcaaagcttcaaaaggaattggatgcaaagagaagctatgtggagtccaaa
cttcaatccattacgaagatgtctgctgacattaacatgtttcccaaacatctgaaagat
gccatggatgaaagagagaaacaaaaaaacaatttaagttacgcgaagggaatgcggcaa
atgtatgagccttttgaaaatttggctcgtgagctccacatgtgcccttgctgtcaacgt
gctttcacacctgatgaagaggatgaatttgtaaagaagcaaaggacaacgtgtgaaagt
actgcagatcgcatgaacaagatctcattggaatgctcaaatgctgaagactttttccag
caattgaataaactcaatgcaacttatgaggaatttgtgaagctgggaaaagaggctata
cctctagcagagaagaacttgaaacaacttttggcggatgaaagtgagaaggcacaaaca
tttgatgattttgtcagtgttcttgctcaagttaaaatggacaaggatgcagtgcaggta
ttgctacagccagttgaaacgattgataggcacgtacaagaaatacagcagttaggacca
caagttgaaaatcttgaatataagcttgatgttcgtggccaaggtgttaaatctttggag
caaatccagttggagttgaactctgtgcagaggacaagggacacattgaacaatgaagtg
gatgatctaagggatcaacaaagaacacttaccgatggtctgactaatgctcagatgcga
tggcatgatattagggaagagaagctaaaagcttcaggtgcagtgcacaaatttcaaaaa
gctgaagaggatttgggacatctagctgaggagaaagaaaaactaacattagaagagaag
catttagaggagtctcttggtccgttgtcaaaagagagagaaagcttgttgcaagagcat
gaagctttgaaggaaaagcttgatcaggagtatcatcagctggcagaaagaaaaagggaa
ttccagcaggaaattgatgcactcgagacacacaatgagcgtatcaaagggtacctgaat
tcaaagaagggcgagaagcttaatgaactacaggaaaaacatactcagttgcagtctgat
ctacagaaaagtaaggaaagaaaagaagaaaaatcggcggagttaagcaagaacaaagag
ctattgaagagccaagatcagttgaaaagaaacattgatgacaaccttaactacaggaga
acaaaggatgaagtggaacgacttactcatgaaatagaattacttgaggacaaaatactt
tccattggcagcctgtctactatagaagcggatcttaagcaacattcacaagaaaaagat
aggcttctttcagagtataataggtgtcaaggaacgcagtccgtttatcaaagtaatatt
tcaaaacacaagcttgaacttaaacagacgcagtacaaggatattgagaagcgatacttt
aaccaacttcttcaactaaagacaactgagatggcaaacaaggacttggaccgatactat
gctgctttggataaggctcttatgcggttccacaccatgaaaatggaggagataaacaaa
ataatcaaggaactgtggcaacagacatataggggccaagatatcgactatataagcatt
aattctgactctgagggtgctggcactcgatcatacagctatcgtgttgtcatgcaaaca
ggtgatgctgagctggaaatgcgagggcgctgcagtgccggccagaaggtgcttgcgtcg
cttataatcagactggcactggcagaaacattctgtctgaactgtggcatattagctcta
gatgagccgaccaccaatctagatgggcctaatgcagagagccttgctggtgcccttttg
agaataatggagagcaggaaagggcaggagaacttccagttgattgtgatcacccatgac
gagaggtttgctcagcttattggtcagaggcagctcgccgagaaatactaccgagtctcc
aaggatgaacaccagcacagcaaaatcgaagcccaggagatctttgactga

DBGET integrated database retrieval system