KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329423
Entry
4329423           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L35
  KO
K02918  large subunit ribosomal protein L35e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4329423
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4329423
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4329423
SSDB
Motif
Pfam: Ribosomal_L29
Other DBs
NCBI-GeneID: 4329423
NCBI-ProteinID: XP_015627286
UniProt: Q0E120 Q6K667
LinkDB
Position
2:17846198..17847872
AA seq 123 aa
MARIKVDELRGKNKAELQAQLKDLKAELSLLRVAKVTGGAPNKLSKIKVVRTSIARVLTV
ISQKQRAALREAYKKKSLLPLDLRPKKTRAIRRRLTKHQLSLKTEREKKREKYFPMRKYA
IKA
NT seq 372 nt   +upstreamnt  +downstreamnt
atggcccggatcaaggtcgacgagctacgggggaagaacaaggcggagctgcaggcccag
ctcaaggacctcaaggcggagctctccctcctccgcgtcgccaaggtcaccggcggcgcc
cccaacaagctctccaagatcaaggtggtgcgcacgtcgatcgcgcgggtgctgacggtg
atctcgcagaagcagagggcggcgctgcgtgaggcgtacaagaagaagagcctcctcccc
ctcgacctccgccccaagaagacccgcgccatccgccgccgcctcaccaagcaccagctt
tcgctgaagacggagagggaaaagaagcgcgagaagtatttccccatgaggaagtatgcc
atcaaggcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335607
Entry
4335607           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L35
  KO
K02918  large subunit ribosomal protein L35e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4335607
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4335607
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4335607
SSDB
Motif
Pfam: Ribosomal_L29
Other DBs
NCBI-GeneID: 4335607
NCBI-ProteinID: XP_015635923
UniProt: A0A0P0W9F1 Q7XMJ1
LinkDB
Position
4:complement(18369230..18371214)
AA seq 123 aa
MARIKVHELRGKNKAELQAQLKDLKAELSLLRVAKVTGGAPNKLSKIKVVRTSIARVLTV
ISQKQKAALREAYKKKSLLPLDLRPKKTRAIRRRLTKHQLSLKTEREKKREKYFPMRKYA
VKA
NT seq 372 nt   +upstreamnt  +downstreamnt
atggcccggatcaaggtgcacgagctccgggggaagaacaaggcggagctgcaggcccag
ctcaaggacctcaaggcggagctctccctcctccgcgtcgccaaggtcaccggcggcgcc
cccaacaagctctccaagatcaaggtggtgcgcacctcgatcgcgcgcgtgctgacggtg
atctcgcagaagcagaaggcggcgctgagggaggcgtacaagaagaagagcctgctcccg
ctcgacctccgccccaagaagacccgcgccatccgcaggcgcctcaccaagcaccagctc
tctttgaagaccgagagggagaagaagcgtgagaagtatttccccatgaggaagtatgct
gttaaagcttag

DBGET integrated database retrieval system